Clone IP06425 Report

Search the DGRC for IP06425

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:25
Vector:pOT2
Associated Gene/TranscriptNpc2d-RA
Protein status:IP06425.pep: gold
Preliminary Size:522
Sequenced Size:682

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12813 2005-01-01 Successful iPCR screen
CG12813 2008-04-29 Release 5.5 accounting
CG12813 2008-08-15 Release 5.9 accounting
CG12813 2008-12-18 5.12 accounting

Clone Sequence Records

IP06425.complete Sequence

682 bp (682 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023607

> IP06425.complete
AAACATGGAAGTTAAGGTGTTGGTTCTGATCTCCCTAGGATTATTACTAT
CGCTGGCTGAGGCTCAGCAGGAGCATCCGGCGACATCTGTGAAGAAATGT
TCCGGAAGTAAACCTTTTCCGCTTGAGGTGCGTGTGCACAATTGCGTTAC
TCCACCCTGTCAGATTGTGAAGGGAACGACACAGAAGTTCGAGATCGATT
TCGCCGTGGACAAGTACATCACCCAGCTGACGACCTTGGTAAAGGCCACC
ACACTCGGAATCATTACGGTGCCATATGAACTGCCTGCGGATGTGGCTGC
CGTGTGCCCGAATCTCCAGTACGGCGCCTATTGCCCGCTGTATCCCACCG
AGGATGTCTCCTATTTGTTCACCTTTCCCATTGGTGAATATCCCGAGATT
GGCGTGAAGATCGAGATCTATCTGGTCGATCAGGACAATGAGATTGCCAC
GTGCTTCGTGTGCGATATTAAGGTGGTCAAGGGCAACGGCGGCAATACGG
TCTATGAGCTGGACTATCTCAACTGAAGTTGGGCCTAGTTAATTCATCAA
TTGGTTTAAATTACTGTGATATAGAATTCTTTATTTTCCAAAATCCATCG
CTGAGCTCCCCCAACGATGTCTCATGAATATGTAATAAAATTTTAAAAGC
TTTACCCCCACAAAAAAAAAAAAAAAAAAAAA

IP06425.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2d-RA 692 Npc2d-RA 18..679 1..662 3310 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5881125..5881687 661..99 2815 100 Minus
chr3R 27901430 chr3R 5881753..5881852 100..1 500 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10055355..10055918 662..99 2820 100 Minus
3R 32079331 3R 10055984..10056083 100..1 500 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9796186..9796749 662..99 2820 100 Minus
3R 31820162 3R 9796815..9796914 100..1 500 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:03:18 has no hits.

IP06425.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:11 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5881125..5881687 99..661 100 <- Minus
chr3R 5881755..5881852 1..98 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:28 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
CG12813-RA 1..522 5..526 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:31 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2d-RA 1..522 5..526 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:23 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2d-RA 1..522 5..526 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:32 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
CG12813-RA 1..522 5..526 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:12 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2d-RA 1..522 5..526 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:36 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
CG12813-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:31 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2d-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:23 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2d-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:33 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
CG12813-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:12 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2d-RA 1..661 1..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:11 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10055356..10055918 99..661 100 <- Minus
3R 10055986..10056083 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:11 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10055356..10055918 99..661 100 <- Minus
3R 10055986..10056083 1..98 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:11 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10055356..10055918 99..661 100 <- Minus
3R 10055986..10056083 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:23 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5881078..5881640 99..661 100 <- Minus
arm_3R 5881708..5881805 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:36 Download gff for IP06425.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9796187..9796749 99..661 100 <- Minus
3R 9796817..9796914 1..98 100   Minus

IP06425.hyp Sequence

Translation from 0 to 525

> IP06425.hyp
NMEVKVLVLISLGLLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCVT
PPCQIVKGTTQKFEIDFAVDKYITQLTTLVKATTLGIITVPYELPADVAA
VCPNLQYGAYCPLYPTEDVSYLFTFPIGEYPEIGVKIEIYLVDQDNEIAT
CFVCDIKVVKGNGGNTVYELDYLN*

IP06425.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2d-PA 173 CG12813-PA 1..173 2..174 907 100 Plus
Npc2e-PB 168 CG31410-PB 4..166 8..174 272 38 Plus
Npc2c-PA 165 CG3934-PA 7..160 10..160 245 37.8 Plus

IP06425.pep Sequence

Translation from 4 to 525

> IP06425.pep
MEVKVLVLISLGLLLSLAEAQQEHPATSVKKCSGSKPFPLEVRVHNCVTP
PCQIVKGTTQKFEIDFAVDKYITQLTTLVKATTLGIITVPYELPADVAAV
CPNLQYGAYCPLYPTEDVSYLFTFPIGEYPEIGVKIEIYLVDQDNEIATC
FVCDIKVVKGNGGNTVYELDYLN*

IP06425.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17136-PA 175 GF17136-PA 1..172 1..173 770 82.7 Plus
Dana\GF17856-PA 164 GF17856-PA 6..160 4..159 261 36.6 Plus
Dana\GF17854-PA 164 GF17854-PA 18..152 26..160 249 40.9 Plus
Dana\GF17855-PA 170 GF17855-PA 8..158 5..160 243 36.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17305-PA 172 GG17305-PA 1..172 1..173 873 98.3 Plus
Dere\GG17324-PA 168 GG17324-PA 4..166 7..173 264 38 Plus
Dere\GG17335-PA 165 GG17335-PA 23..165 26..164 252 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14070-PA 149 GH14070-PA 2..149 25..173 624 79.9 Plus
Dgri\GH14244-PA 204 GH14244-PA 24..162 26..160 244 38.6 Plus
Dgri\GH14243-PA 293 GH14243-PA 127..276 18..160 239 36.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2d-PA 173 CG12813-PA 1..173 1..173 907 100 Plus
Npc2e-PB 168 CG31410-PB 4..166 7..173 272 38 Plus
Npc2c-PA 165 CG3934-PA 7..160 9..159 245 37.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24446-PA 175 GI24446-PA 5..175 7..173 677 77.3 Plus
Dmoj\GI23137-PA 162 GI23137-PA 14..162 11..160 273 39.4 Plus
Dmoj\GI23136-PA 169 GI23136-PA 18..152 26..160 244 40.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27280-PA 162 GL27280-PA 1..162 1..164 646 73.2 Plus
Dper\GL27202-PA 172 GL27202-PA 17..165 26..173 291 42.4 Plus
Dper\GL27203-PA 164 GL27203-PA 6..160 4..159 257 36 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11826-PA 162 GA11826-PA 1..162 1..164 642 72.6 Plus
Dpse\GA16235-PA 172 GA16235-PA 17..165 26..173 290 41.1 Plus
Dpse\GA17784-PA 164 GA17784-PA 6..160 4..159 256 36 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26189-PA 169 GM26189-PA 1..167 1..167 866 100 Plus
Dsec\GM23854-PA 168 GM23854-PA 4..166 7..173 265 38 Plus
Dsec\GM18752-PA 165 GM18752-PA 7..164 9..163 260 38.1 Plus
Dsec\GM19612-PA 140 GM19612-PA 1..135 28..159 249 40.4 Plus
Dsec\GM23855-PA 95 GM23855-PA 1..90 72..159 189 42.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20738-PA 172 GD20738-PA 1..172 1..173 875 98.3 Plus
Dsim\GD18662-PA 168 GD18662-PA 4..166 7..173 270 38 Plus
Dsim\GD11029-PA 792 GD11029-PA 641..790 27..173 260 39.1 Plus
Dsim\GD18663-PA 165 GD18663-PA 23..164 26..163 257 39.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10723-PA 176 GJ10723-PA 22..176 19..173 656 78.7 Plus
Dvir\GJ10438-PA 162 GJ10438-PA 25..161 27..159 251 39.9 Plus
Dvir\GJ10437-PA 135 GJ10437-PA 1..100 62..160 169 39.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12204-PA 172 GK12204-PA 1..172 3..173 709 78.5 Plus
Dwil\GK12205-PA 172 GK12205-PA 1..172 3..173 705 80.8 Plus
Dwil\GK10874-PA 169 GK10874-PA 19..153 26..160 284 43.8 Plus
Dwil\GK10876-PA 163 GK10876-PA 6..163 4..163 247 33.5 Plus
Dwil\GK10875-PA 153 GK10875-PA 18..151 26..159 235 39.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24707-PA 172 GE24707-PA 1..172 1..173 851 95.4 Plus
Dyak\GE26005-PA 168 GE26005-PA 4..166 7..173 260 36.3 Plus
Dyak\GE26006-PA 165 GE26006-PA 6..164 4..163 255 35.2 Plus