Clone IP06447 Report

Search the DGRC for IP06447

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:47
Vector:pOT2
Associated Gene/TranscriptCG13285-RA
Protein status:IP06447.pep: gold
Preliminary Size:597
Sequenced Size:784

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13285 2005-01-01 Successful iPCR screen
CG13285 2008-04-29 Release 5.5 accounting
CG13285 2008-08-15 Release 5.9 accounting
CG13285 2008-12-18 5.12 accounting

Clone Sequence Records

IP06447.complete Sequence

784 bp (784 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024377

> IP06447.complete
CCAAGCAGTTGTCTTGGTTTCCAAAGCTCTCTTGCCGGGAAGTCTACCGT
TCCGCCGTATTCAGATTGTTTTGTTTTTAATATGGTTAAATCCAGTGTCA
TGTTCATCAAGCTATTTACCCTAATGTTGGCCGTGACTGGAGCCTGGAGT
GCCGCCCTCCCAGAAAATCAGGTGGCAACTGCGACCAGGACGACGACAAG
TGATTTGGCAACCGCCGAGACTTCGGCCAAGTTGTTAAATCTCTTTGGAA
CTGGCTCTGGGTATCCGAACTATGGCTACAACTATAATCGTCCGAGCAAC
CCCTACTATCCCGGCTACAATACGAACTACTACGGCTCATCGGGATACTA
TCCCGGCTCGGGATATGGATCTACCACCTACTACCCAAACCAGGGGAGCT
ACGGTTCCTCCGGCTACTACCCAACTCAAGGCTATAACTATTATTCCACT
AGCAGTTATCCGACCACGAACATTCTGGGTAGCCAAGGAGGCGGATACGG
CGGATATGGTGGCTACGGAGGTAATGGAGGTTTTAGGCAATACTCAGGCT
ATTGGCAGCGGGATTATCAGGGTCAGCGGAATCGTGGATATGGCTACTAC
GATGATACAGATCGTTTGGGCCTGCCCATCTCGAGAGATCGTTCCTATGG
TTCGAGTTCCTATCGTGGCTATAACTAATGATGTGCTTTTTGTGTCTGTT
GTTATGGCATTTTTGTTACCGCTTTTGGCCTCTTCCCTCTTGACTAATAA
TAAAATACTTAACCATAAAAAAAAAAAAAAAAAA

IP06447.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13285-RA 868 CG13285-RA 25..791 1..767 3835 100 Plus
CG13285.b 827 CG13285.b 22..542 1..521 2605 100 Plus
CG13285.a 892 CG13285.a 22..542 1..521 2605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5527321..5527854 766..233 2670 100 Minus
chr3L 24539361 chr3L 5528208..5528333 126..1 630 100 Minus
chr3L 24539361 chr3L 5528032..5528138 232..126 505 98.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5534736..5535270 767..233 2675 100 Minus
3L 28110227 3L 5535613..5535738 126..1 630 100 Minus
3L 28110227 3L 5535437..5535543 232..126 535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5527836..5528370 767..233 2675 100 Minus
3L 28103327 3L 5528713..5528838 126..1 630 100 Minus
3L 28103327 3L 5528537..5528643 232..126 535 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:46:20 has no hits.

IP06447.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:47:13 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5527321..5527854 233..766 100 <- Minus
chr3L 5528032..5528137 127..232 98 <- Minus
chr3L 5528208..5528333 1..126 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:31 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 1..597 82..678 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:20 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 1..597 82..678 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:57:30 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 1..597 82..678 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:28 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 1..597 82..678 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:23:37 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 1..597 82..678 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:45 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 1..597 82..678 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:19 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 22..787 1..766 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:57:30 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 22..787 1..766 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:28 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 1..597 82..678 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:23:37 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13285-RA 22..787 1..766 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:47:13 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5534737..5535270 233..766 100 <- Minus
3L 5535437..5535542 127..232 100 <- Minus
3L 5535613..5535738 1..126 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:47:13 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5534737..5535270 233..766 100 <- Minus
3L 5535437..5535542 127..232 100 <- Minus
3L 5535613..5535738 1..126 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:47:13 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5534737..5535270 233..766 100 <- Minus
3L 5535437..5535542 127..232 100 <- Minus
3L 5535613..5535738 1..126 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:57:30 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5527837..5528370 233..766 100 <- Minus
arm_3L 5528537..5528642 127..232 100 <- Minus
arm_3L 5528713..5528838 1..126 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:49 Download gff for IP06447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5528713..5528838 1..126 100   Minus
3L 5527837..5528370 233..766 100 <- Minus
3L 5528537..5528642 127..232 100 <- Minus

IP06447.hyp Sequence

Translation from 0 to 677

> IP06447.hyp
PSSCLGFQSSLAGKSTVPPYSDCFVFNMVKSSVMFIKLFTLMLAVTGAWS
AALPENQVATATRTTTSDLATAETSAKLLNLFGTGSGYPNYGYNYNRPSN
PYYPGYNTNYYGSSGYYPGSGYGSTTYYPNQGSYGSSGYYPTQGYNYYST
SSYPTTNILGSQGGGYGGYGGYGGNGGFRQYSGYWQRDYQGQRNRGYGYY
DDTDRLGLPISRDRSYGSSSYRGYN*

IP06447.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13285-PA 198 CG13285-PA 1..198 28..225 1095 100 Plus
CG13285-PB 154 CG13285-PB 1..147 28..174 805 100 Plus
Edg91-PB 151 CG7539-PB 58..149 83..178 156 45.1 Plus
Edg91-PA 159 CG7539-PA 66..157 83..178 156 45.1 Plus
CG13226-PA 237 CG13226-PA 93..203 85..198 156 37.7 Plus

IP06447.pep Sequence

Translation from 81 to 677

> IP06447.pep
MVKSSVMFIKLFTLMLAVTGAWSAALPENQVATATRTTTSDLATAETSAK
LLNLFGTGSGYPNYGYNYNRPSNPYYPGYNTNYYGSSGYYPGSGYGSTTY
YPNQGSYGSSGYYPTQGYNYYSTSSYPTTNILGSQGGGYGGYGGYGGNGG
FRQYSGYWQRDYQGQRNRGYGYYDDTDRLGLPISRDRSYGSSSYRGYN*

IP06447.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10461-PA 180 GF10461-PA 1..180 7..198 526 70.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14128-PA 760 GG14128-PA 577..760 15..198 865 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16250-PA 204 GH16250-PA 1..188 7..189 248 49.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13285-PA 198 CG13285-PA 1..198 1..198 1095 100 Plus
CG13285-PB 154 CG13285-PB 1..147 1..147 805 100 Plus
Edg91-PB 151 CG7539-PB 58..149 56..151 156 45.1 Plus
Edg91-PA 159 CG7539-PA 66..157 56..151 156 45.1 Plus
CG13226-PA 237 CG13226-PA 93..203 58..171 156 37.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13185-PA 197 GI13185-PA 6..180 10..189 269 55.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10447-PA 735 GA10447-PA 575..717 51..188 247 54.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13916-PA 192 GM13916-PA 1..192 7..198 922 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13193-PA 192 GD13193-PA 1..192 7..198 920 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11961-PA 190 GJ11961-PA 1..176 15..189 266 52.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17309-PA 213 GK17309-PA 1..187 7..187 354 59.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20555-PA 190 GE20555-PA 1..190 7..198 785 93.2 Plus