Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP06451.complete Sequence
696 bp (696 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022521
> IP06451.complete
AAGTAATCAGATATTCACACATAAAATAAATTCAAATAAAATCTGTATAT
TTTGTACGCTCACAATGAACATGAGGGGAATGGCCAAGCGTTCTATTTGG
CTCCAATGTCTTCGGGAAAATGCCACCAATATGCGCCTGGAGCACGAGGA
TCTGGGACGTCGCATTGCTGTTTCTTTGGCCAGTTCCCAGAAAGCTCTAG
TTGATATCGAAAACTTGAATCAAGAGCTGTTAAAAATGAAGGACACAATC
CATAATGCCATTTCCAATGTTATGGGCTACGAAAAGAAGTGTTGTGAATT
GCTCCTGGAAATTTTGATTAAAATAGTTGAGAACAACGACCTGGATGCCG
AACTAAATCCCAAAATGATCTCCAAGGCGTTTCTCGACTTGGATCCGAGT
TCCGACGAGACAGAAGTTCTGAATGACCGTAGTCTTGCAGCGTCTGATTT
TAATCAGCAATATCCAAAAGATGTGCCGGATTCTATTGATATAAACATAA
CAGAAGACCAGTAACCATTTTAAATAGGATCCAAGACCGCACCAATTCGA
TTACTAACGTCTTAATTTAATGCGTTGTCAATTCCACCTCACACATTTAA
AAGGAATAATAAGGTGGTCAGGGCTACAAATGTTTTATATTTTTTATCGA
TTCAATTAAATTTGCATGGTGAAATGACAAAAAAAAAAAAAAAAAA
IP06451.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:42:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13476-RB | 675 | CG13476-RB | 1..675 | 3..677 | 3360 | 99.8 | Plus |
CG13476-RA | 564 | CG13476-RA | 1..344 | 3..346 | 1705 | 99.7 | Plus |
CG13476-RA | 564 | CG13476-RA | 345..564 | 458..677 | 1100 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:29:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 14695618..14696295 | 1..678 | 3375 | 99.9 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14705480..14706161 | 1..682 | 3395 | 99.9 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 14698580..14699261 | 1..682 | 3395 | 99.8 | Plus |
Blast to na_te.dros performed 2019-03-15 23:29:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle2 | 7220 | HMS-Beagle2 Beagle2 7220bp | 680..751 | 73..3 | 123 | 65.3 | Minus |
roo | 9092 | roo DM_ROO 9092bp | 341..386 | 7..52 | 113 | 71.7 | Plus |
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 698..742 | 676..631 | 110 | 73.9 | Minus |
roo | 9092 | roo DM_ROO 9092bp | 9005..9060 | 7..62 | 109 | 66.1 | Plus |
IP06451.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:30:04 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 14695618..14696295 | 1..678 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:33 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..450 | 65..514 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:42 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..450 | 65..514 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:44 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..450 | 65..514 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:31 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..450 | 65..514 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:29 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..450 | 65..514 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:34 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..675 | 3..677 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:42 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..675 | 3..677 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:44 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 17..694 | 1..678 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:31 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 1..675 | 3..677 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:29 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13476-RB | 17..694 | 1..678 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:04 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14705480..14706157 | 1..678 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:04 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14705480..14706157 | 1..678 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:04 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14705480..14706157 | 1..678 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:44 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14698580..14699257 | 1..678 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:36 Download gff for
IP06451.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14698580..14699257 | 1..678 | 99 | | Plus |
IP06451.hyp Sequence
Translation from 0 to 513
> IP06451.hyp
SNQIFTHKINSNKICIFCTLTMNMRGMAKRSIWLQCLRENATNMRLEHED
LGRRIAVSLASSQKALVDIENLNQELLKMKDTIHNAISNVMGYEKKCCEL
LLEILIKIVENNDLDAELNPKMISKAFLDLDPSSDETEVLNDRSLAASDF
NQQYPKDVPDSIDINITEDQ*
IP06451.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:43:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13476-PB | 149 | CG13476-PB | 1..149 | 22..170 | 755 | 100 | Plus |
IP06451.pep Sequence
Translation from 64 to 513
> IP06451.pep
MNMRGMAKRSIWLQCLRENATNMRLEHEDLGRRIAVSLASSQKALVDIEN
LNQELLKMKDTIHNAISNVMGYEKKCCELLLEILIKIVENNDLDAELNPK
MISKAFLDLDPSSDETEVLNDRSLAASDFNQQYPKDVPDSIDINITEDQ*
IP06451.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:46:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20082-PA | 145 | GF20082-PA | 6..107 | 9..103 | 209 | 45.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:46:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15693-PA | 162 | GG15693-PA | 1..149 | 1..149 | 511 | 69.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13476-PB | 149 | CG13476-PB | 1..149 | 1..149 | 755 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:46:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25476-PA | 112 | GM25476-PA | 1..112 | 1..149 | 481 | 67.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:46:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14499-PA | 112 | GD14499-PA | 1..112 | 1..149 | 476 | 66.4 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:46:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11675-PA | 123 | GJ11675-PA | 1..67 | 1..67 | 136 | 41.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:46:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22024-PA | 161 | GE22024-PA | 1..148 | 1..149 | 541 | 74 | Plus |