Clone IP06451 Report

Search the DGRC for IP06451

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:51
Vector:pOT2
Associated Gene/TranscriptCG13476-RB
Protein status:IP06451.pep: gold
Preliminary Size:571
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13476 2005-01-01 Successful iPCR screen
CG13476 2008-04-29 Release 5.5 accounting
CG13476 2008-08-15 Release 5.9 accounting
CG13476 2008-12-18 5.12 accounting

Clone Sequence Records

IP06451.complete Sequence

696 bp (696 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022521

> IP06451.complete
AAGTAATCAGATATTCACACATAAAATAAATTCAAATAAAATCTGTATAT
TTTGTACGCTCACAATGAACATGAGGGGAATGGCCAAGCGTTCTATTTGG
CTCCAATGTCTTCGGGAAAATGCCACCAATATGCGCCTGGAGCACGAGGA
TCTGGGACGTCGCATTGCTGTTTCTTTGGCCAGTTCCCAGAAAGCTCTAG
TTGATATCGAAAACTTGAATCAAGAGCTGTTAAAAATGAAGGACACAATC
CATAATGCCATTTCCAATGTTATGGGCTACGAAAAGAAGTGTTGTGAATT
GCTCCTGGAAATTTTGATTAAAATAGTTGAGAACAACGACCTGGATGCCG
AACTAAATCCCAAAATGATCTCCAAGGCGTTTCTCGACTTGGATCCGAGT
TCCGACGAGACAGAAGTTCTGAATGACCGTAGTCTTGCAGCGTCTGATTT
TAATCAGCAATATCCAAAAGATGTGCCGGATTCTATTGATATAAACATAA
CAGAAGACCAGTAACCATTTTAAATAGGATCCAAGACCGCACCAATTCGA
TTACTAACGTCTTAATTTAATGCGTTGTCAATTCCACCTCACACATTTAA
AAGGAATAATAAGGTGGTCAGGGCTACAAATGTTTTATATTTTTTATCGA
TTCAATTAAATTTGCATGGTGAAATGACAAAAAAAAAAAAAAAAAA

IP06451.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13476-RB 675 CG13476-RB 1..675 3..677 3360 99.8 Plus
CG13476-RA 564 CG13476-RA 1..344 3..346 1705 99.7 Plus
CG13476-RA 564 CG13476-RA 345..564 458..677 1100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14695618..14696295 1..678 3375 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14705480..14706161 1..682 3395 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14698580..14699261 1..682 3395 99.8 Plus
Blast to na_te.dros performed 2019-03-15 23:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 680..751 73..3 123 65.3 Minus
roo 9092 roo DM_ROO 9092bp 341..386 7..52 113 71.7 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 698..742 676..631 110 73.9 Minus
roo 9092 roo DM_ROO 9092bp 9005..9060 7..62 109 66.1 Plus

IP06451.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:30:04 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14695618..14696295 1..678 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:33 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..450 65..514 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:42 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..450 65..514 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:44 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..450 65..514 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:31 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..450 65..514 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:29 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..450 65..514 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:34 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..675 3..677 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:42 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..675 3..677 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:44 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 17..694 1..678 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:31 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 1..675 3..677 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:29 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
CG13476-RB 17..694 1..678 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:04 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14705480..14706157 1..678 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:04 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14705480..14706157 1..678 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:04 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14705480..14706157 1..678 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:44 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14698580..14699257 1..678 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:36 Download gff for IP06451.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14698580..14699257 1..678 99   Plus

IP06451.hyp Sequence

Translation from 0 to 513

> IP06451.hyp
SNQIFTHKINSNKICIFCTLTMNMRGMAKRSIWLQCLRENATNMRLEHED
LGRRIAVSLASSQKALVDIENLNQELLKMKDTIHNAISNVMGYEKKCCEL
LLEILIKIVENNDLDAELNPKMISKAFLDLDPSSDETEVLNDRSLAASDF
NQQYPKDVPDSIDINITEDQ*

IP06451.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13476-PB 149 CG13476-PB 1..149 22..170 755 100 Plus

IP06451.pep Sequence

Translation from 64 to 513

> IP06451.pep
MNMRGMAKRSIWLQCLRENATNMRLEHEDLGRRIAVSLASSQKALVDIEN
LNQELLKMKDTIHNAISNVMGYEKKCCELLLEILIKIVENNDLDAELNPK
MISKAFLDLDPSSDETEVLNDRSLAASDFNQQYPKDVPDSIDINITEDQ*

IP06451.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20082-PA 145 GF20082-PA 6..107 9..103 209 45.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15693-PA 162 GG15693-PA 1..149 1..149 511 69.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13476-PB 149 CG13476-PB 1..149 1..149 755 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25476-PA 112 GM25476-PA 1..112 1..149 481 67.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14499-PA 112 GD14499-PA 1..112 1..149 476 66.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11675-PA 123 GJ11675-PA 1..67 1..67 136 41.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22024-PA 161 GE22024-PA 1..148 1..149 541 74 Plus