Clone IP06461 Report

Search the DGRC for IP06461

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:61
Vector:pOT2
Associated Gene/TranscriptCG13663-RA
Protein status:IP06461.pep: gold
Preliminary Size:534
Sequenced Size:819

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13663 2005-01-01 Successful iPCR screen
CG13663 2008-04-29 Release 5.5 accounting
CG13663 2008-08-15 Release 5.9 accounting
CG13663 2008-12-18 5.12 accounting

Clone Sequence Records

IP06461.complete Sequence

819 bp (819 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023608

> IP06461.complete
TCCAGCTTAGTTTATTTACAATTTGGGCAAAATCAGTGAAGTTGCAATTT
ATGGCTGATTTTCAAGAACAGCTGCGACAGTATCGCGCTCAGAAAAGGAG
AAAGGAAACGGTAGACAACTTCAAGGACAAACTACGGAGATTCTGGATGT
TGGGAACCGGGGCTAATAAAGATACCACAATAGAGGTACAACAGGTACCT
ACTAAGTTCGAAGCTATCTCGGAAAACTCACAAGATGAGGCTGTGACCTC
CAGTGAAAGTGAATTGGTGCCAGAGGAGCAGCCCACCAGATCCACAGATC
ATCACCACAAGGAAAACAACTGCCTAAAGTACACCCTCTGGACTGTCTAT
CTGCTGTTCTGGATAACTCTCTACGTTATTGCCATAAAGCTAAGCTTTGG
ATTGGTTTTCCTCATGTTTTCCGCCCTCTTTGGCATCTACTTCAACACCC
GAACGGAGCCAAAGAAACGGAACGAGATGAGTGCCTACAGCGTTTTCAAC
AAGAATTGCGAGAGTATAGACGGCACCTTGAAGGCCGAGCAGTTCGAAAG
GGAAATCCGCTATGGATCCGGAAGTGTACGATAGTCTTACGAGTATATCA
TGAGATAATCTAAATACTGTAGTCTAGACAATTTTATAATATATTCACTA
ACTTGTATCTTATGTAGCTATGTGGCTGTAAAAGTATATTTTATTATGTG
TTATTGGTTTCTATCCTTATCTTCTCAAGAGATTTTTATTAAACATGACA
TGTTGATCTTACCTTTTGTTAATCATACAAATGTAGCCGAAATAACTACA
GTAAAAAAAAAAAAAAAAA

IP06461.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13663-RA 990 CG13663-RA 47..849 1..803 4015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21037410..21038019 802..193 3020 99.7 Minus
chr3R 27901430 chr3R 21038077..21038273 197..1 985 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25214324..25214934 803..193 3055 100 Minus
3R 32079331 3R 25214992..25215188 197..1 985 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24955155..24955765 803..193 3055 100 Minus
3R 31820162 3R 24955823..24956019 197..1 985 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:57:17 has no hits.

IP06461.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:57:59 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21037410..21038017 195..802 99 <- Minus
chr3R 21038080..21038273 1..194 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:36 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..534 51..584 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:09 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..534 51..584 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:58:33 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..534 51..584 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:37 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..534 51..584 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:57:32 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..534 51..584 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:05 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..802 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:09 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..802 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:58:33 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..802 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:37 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..802 1..802 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:57:32 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
CG13663-RA 1..802 1..802 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:59 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25214325..25214932 195..802 100 <- Minus
3R 25214995..25215188 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:59 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25214325..25214932 195..802 100 <- Minus
3R 25214995..25215188 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:57:59 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25214325..25214932 195..802 100 <- Minus
3R 25214995..25215188 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:58:33 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21040047..21040654 195..802 100 <- Minus
arm_3R 21040717..21040910 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:08 Download gff for IP06461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24955156..24955763 195..802 100 <- Minus
3R 24955826..24956019 1..194 100   Minus

IP06461.hyp Sequence

Translation from 2 to 583

> IP06461.hyp
QLSLFTIWAKSVKLQFMADFQEQLRQYRAQKRRKETVDNFKDKLRRFWML
GTGANKDTTIEVQQVPTKFEAISENSQDEAVTSSESELVPEEQPTRSTDH
HHKENNCLKYTLWTVYLLFWITLYVIAIKLSFGLVFLMFSALFGIYFNTR
TEPKKRNEMSAYSVFNKNCESIDGTLKAEQFEREIRYGSGSVR*

IP06461.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13663-PA 177 CG13663-PA 1..177 17..193 923 100 Plus

IP06461.pep Sequence

Translation from 50 to 583

> IP06461.pep
MADFQEQLRQYRAQKRRKETVDNFKDKLRRFWMLGTGANKDTTIEVQQVP
TKFEAISENSQDEAVTSSESELVPEEQPTRSTDHHHKENNCLKYTLWTVY
LLFWITLYVIAIKLSFGLVFLMFSALFGIYFNTRTEPKKRNEMSAYSVFN
KNCESIDGTLKAEQFEREIRYGSGSVR*

IP06461.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17092-PA 182 GF17092-PA 1..182 1..177 741 78.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12278-PA 177 GG12278-PA 1..177 1..177 910 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19568-PA 176 GH19568-PA 1..176 1..177 615 65.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13663-PA 177 CG13663-PA 1..177 1..177 923 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23864-PA 178 GI23864-PA 1..178 1..177 581 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21933-PA 318 GL21933-PA 1..67 1..67 181 50.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12444-PA 177 GA12444-PA 1..177 1..177 625 69.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17742-PA 177 GM17742-PA 1..177 1..177 943 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18226-PA 177 GD18226-PA 1..177 1..177 941 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10578-PA 181 GJ10578-PA 1..181 1..177 580 60.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13395-PA 182 GK13395-PA 1..182 1..177 642 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10727-PA 177 GE10727-PA 1..177 1..177 917 94.9 Plus