Clone IP06473 Report

Search the DGRC for IP06473

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:73
Vector:pOT2
Associated Gene/TranscriptCG14130-RA
Protein status:IP06473.pep: gold
Preliminary Size:621
Sequenced Size:1050

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14130 2005-01-01 Successful iPCR screen
CG14130 2008-04-29 Release 5.5 accounting
CG14130 2008-08-15 Release 5.9 accounting
CG14130 2008-12-18 5.12 accounting

Clone Sequence Records

IP06473.complete Sequence

1050 bp (1050 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022529

> IP06473.complete
TTTACACGTAACTTTCAAGAAATGATTATCCAGAACAGAAGTCCTCTTAT
AGGCCACATTTTGAGACGGTGCCATCGCCAAGCGGTGGAAAGCAACGCTA
TAAAAGCCAATTTAACAGCATATTTTGGAAAATGGCCCGAAACGGAGCAG
AAGGAGTTTCGCCAGCATATGCGCATCATCACGGATTTCATTAGTGAGCC
AGAGGAACAGCAGCTGCACGAGGAGATCGAGCCCTATATGAGCCGTCTGC
GCTACGAGTTCGATCACTGGGACGATGCCATACACGGTTTTCGGGAGACG
GAGCGAAAGAAGTGGTTCCCTAAAAACAGAGAGATCCTGGAGCGCGTGCG
CCAAGTCGCCTTCGATGGAGCAGTTATGCCCTATGTCCACATCCTAGATC
TTGCACCCGATGGCGTTATCAAGCCCCATGTGGATAGCACGAGATACTGC
GGCAACACCATCTCTGGAATCAGCCTACTTAGCGACAGTGTGATGCGACT
TGTGCGCACGGATGAGCAGCGGTACCAACAGCAATCGTCGGGAACTGCAA
CGGATCCGAATTCCCAGGGGTCAGAACCCGATGCAGCCTATCGCCATCAA
CCGGAGGCGTCTCTAAAGAACAACTTCTACGCTGACATCCTGTTGCCGCG
CCGCTCCTTGTACATAATGAGCCACACGGCTCGCTACAAATTCACACACG
AGATACTAGCTAAGGAGCACTCCCAGTTTCAGGGTGCGCTGGTGCCCAGG
ACACGTCGCATTTCCATCATTTGTCGCAACGAACCCTGAAGTTTTTTAAA
TAAACTTTAAATTATTATTTACTGCAGTTGCAAAAGATAATTTTTGTTAA
AAGTAGTTAGCATAGAATTTGTTAGTACATTTTAATAAAATTTCAAGCGA
ACTGAACGTTTTTGTTTGACTGAATGGCCATTAAAAACGAAGTAAAAATC
AATAGGAGTCAGAACATTCAGTTCATAAATGAATCACATATTAATTAACA
ACAATACTTATGAAATAAATTAATTACAAACGAAAAAAAAAAAAAAAAAA

IP06473.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14130.c 1300 CG14130.c 56..1089 1..1034 5170 100 Plus
CG14130.b 1269 CG14130.b 104..1058 80..1034 4775 100 Plus
CG14130.a 1056 CG14130.a 104..1056 80..1032 4765 100 Plus
CG14130.b 1269 CG14130.b 1..82 1..82 410 100 Plus
CG14130.a 1056 CG14130.a 1..82 1..82 410 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11806993..11807580 445..1032 2850 99 Plus
chr3L 24539361 chr3L 11806496..11806693 80..277 990 100 Plus
chr3L 24539361 chr3L 11806761..11806928 277..444 840 100 Plus
chr3L 24539361 chr3L 11806349..11806430 1..82 410 100 Plus
chr3L 24539361 chr3L 11828480..11828544 850..786 250 92.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11816123..11816712 445..1034 2950 100 Plus
3L 28110227 3L 11815626..11815823 80..277 990 100 Plus
3L 28110227 3L 11815891..11816058 277..444 840 100 Plus
3L 28110227 3L 11815479..11815560 1..82 410 100 Plus
3L 28110227 3L 11837647..11837711 850..786 250 92.3 Minus
3L 28110227 3L 11837713..11837764 631..580 185 90.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11809223..11809812 445..1034 2950 100 Plus
3L 28103327 3L 11808726..11808923 80..277 990 100 Plus
3L 28103327 3L 11808991..11809158 277..444 840 100 Plus
3L 28103327 3L 11808579..11808660 1..82 410 100 Plus
3L 28103327 3L 11830747..11830811 850..786 250 92.3 Minus
3L 28103327 3L 11830813..11830864 631..580 185 90.3 Minus
Blast to na_te.dros performed on 2019-03-16 01:56:54 has no hits.

IP06473.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:58:03 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11806761..11806928 277..444 100 -> Plus
chr3L 11806349..11806430 1..82 100 -> Plus
chr3L 11806499..11806692 83..276 100 -> Plus
chr3L 11806993..11807580 445..1032 93   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:40 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..768 22..789 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:47 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..768 22..789 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:12 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..768 22..789 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:36 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..768 22..789 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:52:05 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..768 22..789 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:41 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..1032 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:47 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..1032 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:12 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..1032 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:36 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 1..1032 1..1032 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:52:05 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
CG14130-RA 36..1067 1..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:03 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11815479..11815560 1..82 100 -> Plus
3L 11815629..11815822 83..276 100 -> Plus
3L 11815891..11816058 277..444 100 -> Plus
3L 11816123..11816710 445..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:03 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11815479..11815560 1..82 100 -> Plus
3L 11815629..11815822 83..276 100 -> Plus
3L 11815891..11816058 277..444 100 -> Plus
3L 11816123..11816710 445..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:58:03 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11815479..11815560 1..82 100 -> Plus
3L 11815629..11815822 83..276 100 -> Plus
3L 11815891..11816058 277..444 100 -> Plus
3L 11816123..11816710 445..1032 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:12 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11808579..11808660 1..82 100 -> Plus
arm_3L 11808729..11808922 83..276 100 -> Plus
arm_3L 11808991..11809158 277..444 100 -> Plus
arm_3L 11809223..11809810 445..1032 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:41 Download gff for IP06473.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11809223..11809810 445..1032 100   Plus
3L 11808579..11808660 1..82 100 -> Plus
3L 11808729..11808922 83..276 100 -> Plus
3L 11808991..11809158 277..444 100 -> Plus

IP06473.hyp Sequence

Translation from 0 to 788

> IP06473.hyp
FTRNFQEMIIQNRSPLIGHILRRCHRQAVESNAIKANLTAYFGKWPETEQ
KEFRQHMRIITDFISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRET
ERKKWFPKNREILERVRQVAFDGAVMPYVHILDLAPDGVIKPHVDSTRYC
GNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQGSEPDAAYRHQ
PEASLKNNFYADILLPRRSLYIMSHTARYKFTHEILAKEHSQFQGALVPR
TRRISIICRNEP*

IP06473.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14130-PA 255 CG14130-PA 1..255 8..262 1349 100 Plus

IP06473.pep Sequence

Translation from 21 to 788

> IP06473.pep
MIIQNRSPLIGHILRRCHRQAVESNAIKANLTAYFGKWPETEQKEFRQHM
RIITDFISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFP
KNREILERVRQVAFDGAVMPYVHILDLAPDGVIKPHVDSTRYCGNTISGI
SLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQGSEPDAAYRHQPEASLKN
NFYADILLPRRSLYIMSHTARYKFTHEILAKEHSQFQGALVPRTRRISII
CRNEP*

IP06473.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24508-PA 248 GF24508-PA 2..248 1..255 1089 79.3 Plus
Dana\GF22171-PA 700 GF22171-PA 20..211 30..252 590 52 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13880-PA 257 GG13880-PA 1..257 1..255 1272 92.2 Plus
Dere\GG12876-PA 219 GG12876-PA 24..219 30..255 649 56.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16721-PA 246 GH16721-PA 1..246 1..255 990 71.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14130-PA 255 CG14130-PA 1..255 1..255 1349 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13804-PA 246 GI13804-PA 1..246 1..255 1006 74.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20813-PA 183 GL20813-PA 1..183 73..255 773 76 Plus
Dper\GL20812-PA 69 GL20812-PA 1..56 1..56 174 58.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12780-PA 255 GA12780-PA 1..255 1..255 1030 72.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25300-PA 255 GM25300-PA 1..255 1..255 1322 95.3 Plus
Dsec\GM24701-PA 296 GM24701-PA 37..67 111..141 163 90.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14332-PA 255 GD14332-PA 1..255 1..255 1356 98 Plus
Dsim\GD12770-PA 825 GD12770-PA 1..68 50..117 355 94.1 Plus
Dsim\GD24723-PA 195 GD24723-PA 26..195 31..255 236 32.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11670-PA 246 GJ11670-PA 1..246 1..255 1006 73.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13660-PA 258 GK13660-PA 1..258 1..255 975 71.4 Plus
Dwil\GK25028-PA 181 GK25028-PA 1..173 50..252 446 46.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21850-PA 255 GE21850-PA 1..255 1..255 1284 92.2 Plus
Dyak\GE20172-PA 205 GE20172-PA 1..205 1..255 960 73.3 Plus
Dyak\GE16706-PA 121 GE16706-PA 1..121 105..255 398 56.3 Plus