Clone IP06475 Report

Search the DGRC for IP06475

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:75
Vector:pOT2
Associated Gene/TranscriptCG6709-RA
Protein status:IP06475.pep: gold
Preliminary Size:561
Sequenced Size:1341

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14164 2005-01-01 Successful iPCR screen
CG14164 2008-04-29 Release 5.5 accounting
CG6709 2008-08-15 Release 5.9 accounting
CG14164 2008-08-15 Release 5.9 accounting
CG6709 2008-12-18 5.12 accounting
CG14164 2008-12-18 5.12 accounting

Clone Sequence Records

IP06475.complete Sequence

1341 bp (1341 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022530.1

> IP06475.complete
ACTTGACATCGGACATCGGCTGGGATTTTCGATTTCGATTACATTTTTAA
AGTTTTTAAGTTCCTTGGCCAAGATGTCATCATTGGCTCCTTGCTTTACT
GTGGGCTCTATTGTGCGCTGCAAGACTTGTTTTGGCGACAACATTTCGGG
CGAGGTTGTGGCCTTCGATCTGGGCGTGATGCTGATAATGAAGTGTCCAT
CAAGCAATGGCGGTGGCGACGAACAGACCACTTGCAATGTGACCATTGTG
AACCTATCCCCATGGACATTGAAATAGTAAAGGAAGCAATTCCGCCGGCT
GAAGTTCAACAGCCAGAACCGATTGATTTGCCCATGATCCGAGAACGATA
CCGATACGCAACCGAACATCGTACGCTCTCCTGCCGGAGCTATCATCCCA
ATGCCTCGCCCTTTGGTCAAGCTCTGTTCAGACTGTTAGTCAAGCGATTC
GGTGATCCCGCTATCATCTGGCAGAACAAAGGCGACCAAGTGGCGATCAA
TATACTCCGTCAGGTGGTCATCGATGCGCCGTATGCCACGGAGAATATCC
GATACCTCGATTGGAATCCCAAGCTGGCGATATGCGTCCAAGAGGTCGTT
CAAAACTTTTGCAGTAAACAATTCTAGAACGATGGCCCGTGCCCATGGCA
ACAGTTGTCTAGATAGCATCCGATTCTCTGTACGTTTTGTTTATCAACAA
AACAATTCAAAATACACATACATATAGCCATGACACCCACACAGAATACT
GCTCTTTATCTGCCAGGGGAAACCATTCTCGTTTGTACAAATTCGATTTA
ATACACTACACCACAACACCCAACACACATAATACACGATGGCCGATGAT
GAAGATAAACCAAAGAAGCACACGCTGGACAGCCTGTTCTTGGTGTATTC
CAACTTCCAGGTCATACCCACCGACATCGAGAACGAGTACTTTGACAGCA
TACTCCTCTCGCAGTTGGACGCCTGGCTAGAGCAGGCCAAGCTCATGCCC
AATCCCATAACTCGAACTCAGACCGGTTTAATATACATGCGATACAAGAA
ATGGCGTTTGGAGTACGAAGACTTTCTCGAGGTCCTAAATAACTTGGCAT
CCGATAACAATCTGGCTATAGATGAAATGAAGCAAATAATGATCGATGCT
GGCGTCCCGAATGGTGCTGATGTAGTTATAGTCGTCAAGTAGATTGAATC
ATCACTGCATTTTATTTATATGCATACAAAAAGTCGGACAACAAATTATT
AATAGTAACAATTGCATACAAGAGTAACTTTGATTAATTCACAAAAATTA
TAGTAAAATATAAAAGCATCCAACAAAAAAAAAAAAAAAAA

IP06475.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14164-RB 1336 CG14164-RB 1..1336 1..1329 6525 99.4 Plus
CG6709-RB 1336 CG6709-RB 1..1336 1..1329 6525 99.4 Plus
CG14164-RA 746 CG14164-RA 1..746 1..739 3575 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9885505..9886080 912..336 2730 98.6 Minus
chr3L 24539361 chr3L 9884981..9885257 1324..1048 1310 98.2 Minus
chr3L 24539361 chr3L 9886385..9886540 156..1 780 100 Minus
chr3L 24539361 chr3L 9886141..9886331 336..153 765 95.8 Minus
chr3L 24539361 chr3L 9885310..9885450 1048..908 675 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9893707..9894283 912..336 2885 100 Minus
3L 28110227 3L 9893183..9893464 1329..1048 1410 100 Minus
3L 28110227 3L 9894344..9894534 336..153 780 96.3 Minus
3L 28110227 3L 9894588..9894743 156..1 780 100 Minus
3L 28110227 3L 9893517..9893658 1048..907 710 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9886807..9887383 912..336 2885 100 Minus
3L 28103327 3L 9886283..9886564 1329..1048 1410 100 Minus
3L 28103327 3L 9887444..9887634 336..153 800 96.3 Minus
3L 28103327 3L 9887688..9887843 156..1 780 100 Minus
3L 28103327 3L 9886617..9886758 1048..907 710 100 Minus
Blast to na_te.dros performed 2019-03-16 16:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 1430..1600 693..867 143 59.8 Plus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 733..798 661..730 115 67.1 Plus

IP06475.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:06:43 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9884981..9885257 1048..1324 98 <- Minus
chr3L 9885311..9885447 911..1047 98 <- Minus
chr3L 9885507..9886079 337..910 98 <- Minus
chr3L 9886141..9886329 155..336 95 <- Minus
chr3L 9886387..9886540 1..154 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:43 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RB 1..561 74..627 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:29 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RB 1..561 74..627 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:00:04 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RA 1..561 74..627 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:18 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RB 1..561 74..627 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:19:13 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RA 1..561 74..627 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:07 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RB 1..1331 1..1324 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:29 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG6709-RB 1..1331 1..1324 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:00:04 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RB 1..1331 1..1324 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:19 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG14164-RB 1..1331 1..1324 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:19:13 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
CG6709-RB 1..1331 1..1324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:43 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9893518..9893654 911..1047 100 <- Minus
3L 9893188..9893464 1048..1324 100 <- Minus
3L 9893709..9894282 337..910 100 <- Minus
3L 9894344..9894532 155..336 96 <- Minus
3L 9894590..9894743 1..154 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:43 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9893518..9893654 911..1047 100 <- Minus
3L 9893188..9893464 1048..1324 100 <- Minus
3L 9893709..9894282 337..910 100 <- Minus
3L 9894344..9894532 155..336 96 <- Minus
3L 9894590..9894743 1..154 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:06:43 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9893518..9893654 911..1047 100 <- Minus
3L 9893188..9893464 1048..1324 100 <- Minus
3L 9893709..9894282 337..910 100 <- Minus
3L 9894344..9894532 155..336 96 <- Minus
3L 9894590..9894743 1..154 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:00:04 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9886288..9886564 1048..1324 100 <- Minus
arm_3L 9886618..9886754 911..1047 100 <- Minus
arm_3L 9886809..9887382 337..910 100 <- Minus
arm_3L 9887444..9887632 155..336 96 <- Minus
arm_3L 9887690..9887843 1..154 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:24 Download gff for IP06475.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9886618..9886754 911..1047 100 <- Minus
3L 9886288..9886564 1048..1324 100 <- Minus
3L 9886809..9887382 337..910 100 <- Minus
3L 9887444..9887632 155..336 96 <- Minus
3L 9887690..9887843 1..154 100   Minus

IP06475.hyp Sequence

Translation from 0 to 626

> IP06475.hyp
LDIGHRLGFSISITFLKFLSSLAKMSSLAPCFTVGSIVRCKTCFGDNISG
EVVAFDLGVKMLIMKCPSSNGGGDEQTTCNVTIVNLSLCMDIEIVKEAIP
PAEVQQPEPIDLPMIRERYRYATEHRTLSCRSYHPNASPFGQALFRLLVK
RFGDPAIIWQNKGDQVAINILRQVVIDAPYATENIRYLDWNPKLAICVQE
VVQNFCSKQF*

IP06475.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14164-PB 186 CG14164-PB 1..186 25..210 987 100 Plus
CG14164-PA 186 CG14164-PA 1..186 25..210 987 100 Plus
CG15735-PA 217 CG15735-PA 4..179 20..205 261 29.6 Plus

IP06475.pep Sequence

Translation from 838 to 1191

> IP06475.pep
MADDEDKPKKHTLDSLFLVYSNFQVIPTDIENEYFDSILLSQLDAWLEQA
KLMPNPITRTQTGLIYMRYKKWRLEYEDFLEVLNNLASDNNLAIDEMKQI
MIDAGVPNGADVVIVVK*

IP06475.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23855-PA 117 GF23855-PA 1..117 1..117 513 78.6 Plus
Dana\GF24388-PA 201 GF24388-PA 37..136 3..108 140 31.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13995-PA 117 GG13995-PA 1..117 1..117 582 94 Plus
Dere\GG13461-PA 203 GG13461-PA 41..138 5..108 140 31.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15412-PA 117 GH15412-PA 1..117 1..117 425 67.5 Plus
Dgri\GH15597-PA 192 GH15597-PA 29..127 5..108 142 31.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6709-PB 117 CG6709-PB 1..117 1..117 604 100 Plus
CG6709-PA 117 CG6709-PA 1..117 1..117 604 100 Plus
ringer-PB 192 CG45057-PB 30..131 5..112 138 31.5 Plus
ringer-PD 192 CG45057-PD 30..131 5..112 138 31.5 Plus
ringer-PC 192 CG45057-PC 30..131 5..112 138 31.5 Plus
ringer-PA 192 CG45057-PA 30..131 5..112 138 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13015-PA 117 GI13015-PA 1..117 1..117 447 70.1 Plus
Dmoj\GI11286-PA 186 GI11286-PA 23..121 5..108 134 29.8 Plus
Dmoj\GI16876-PA 186 GI16876-PA 23..121 5..108 134 29.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11875-PA 117 GL11875-PA 1..117 1..117 471 70.9 Plus
Dper\GL18002-PA 226 GL18002-PA 59..165 1..112 138 29.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19802-PA 117 GA19802-PA 1..117 1..117 470 70.1 Plus
Dpse\GA18507-PA 205 GA18507-PA 38..144 1..112 140 29.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24831-PA 117 GM24831-PA 1..117 1..117 600 98.3 Plus
Dsec\GM24410-PA 203 GM24410-PA 41..138 5..108 140 31.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12883-PA 117 GD12883-PA 1..117 1..117 600 98.3 Plus
Dsim\GD12480-PA 203 GD12480-PA 41..138 5..108 139 31.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12108-PA 117 GJ12108-PA 1..117 1..117 425 68.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17417-PA 117 GK17417-PA 1..117 1..117 480 73.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20291-PA 117 GE20291-PA 1..117 1..117 580 93.2 Plus
Dyak\GE22559-PA 203 GE22559-PA 41..138 5..108 139 31.7 Plus
Dyak\GE22907-PA 203 GE22907-PA 41..138 5..108 137 31.7 Plus