IP06488.complete Sequence
648 bp (648 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023605
> IP06488.complete
CTAAACTGAACTGCCTATAAATTTCAAGTCTCAAAATGTCCCTCAATTGC
CCGGTTCATAATAAGAACTCCAGTGGCTTAAACATTACCAGGTCCGCAAC
CTCGGATGACGTCAAGATCGCCATGTGCGCCTGCTTGGAATTGGCCAACT
GTCGGGCCGAAAACTGTCAGCTGAAGAAGAAACTGACCGAATATGAGGCC
AAGATCTGCAGTCTCGAACAACTGGTGGCCACCATTGCGGAGGAGCAGAA
CCAGATTCGCCAAGAAGTGATCGAGTTGCGCAATGAGACTCAGGGTGCAA
CGATGGAAGCCGCCAACGAGGTGGATCCTTTGGACAACTCATTCGTGAAC
CCGCAAGAGGAAATGGACGATGAGGAAGGATACGATCCGGATTCAGAATC
CGAGTACAATGCTATCCAGTCCCCCAATCCCTCAATACATTCTTCGATGG
TCTCGCTGGTTCGCTCATTGAGTTTTTCATCCACCAGCTCAGATTCTGAT
TGCATTGTATACAGCGATAATGAGGATTTCTAAGAAACCCATCTCATTCC
AATCGCATCTTCTCAACAAGTTCCGTTCGCGAACTTTGATACCACACGAT
ATGAGTAAACGACAATGTTAAAATAAAAAAAAAAAAAAAAAAAAAAAA
IP06488.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:45:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14384-RA | 707 | CG14384-RA | 84..707 | 1..624 | 3120 | 100 | Plus |
Cyp304a1-RA | 2025 | Cyp304a1-RA | 1985..2025 | 627..587 | 205 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:38:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 8791176..8791718 | 624..82 | 2700 | 99.8 | Minus |
chr3R | 27901430 | chr3R | 8791791..8791875 | 85..1 | 425 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:38:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 12965935..12966480 | 627..82 | 2715 | 99.8 | Minus |
3R | 32079331 | 3R | 12966553..12966637 | 85..1 | 425 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 12706766..12707311 | 627..82 | 2715 | 99.8 | Minus |
3R | 31820162 | 3R | 12707384..12707468 | 85..1 | 425 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 15:38:51 has no hits.
IP06488.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:39:35 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 8791176..8791714 | 86..624 | 100 | <- | Minus |
chr3R | 8791791..8791875 | 1..85 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:47 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 1..498 | 36..533 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:59 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 1..498 | 36..533 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:08 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 1..498 | 36..533 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:23 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 1..498 | 36..533 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:48 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 1..498 | 36..533 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:33 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 84..707 | 1..624 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:58 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 84..707 | 1..624 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:08 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 84..707 | 1..624 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:23 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 84..707 | 1..624 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:48 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14384-RA | 84..707 | 1..624 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:35 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12966553..12966637 | 1..85 | 100 | | Minus |
3R | 12965938..12966476 | 86..624 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:35 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12966553..12966637 | 1..85 | 100 | | Minus |
3R | 12965938..12966476 | 86..624 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:35 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12966553..12966637 | 1..85 | 100 | | Minus |
3R | 12965938..12966476 | 86..624 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:08 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8791660..8792198 | 86..624 | 100 | <- | Minus |
arm_3R | 8792275..8792359 | 1..85 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:58 Download gff for
IP06488.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12706769..12707307 | 86..624 | 100 | <- | Minus |
3R | 12707384..12707468 | 1..85 | 100 | | Minus |
IP06488.hyp Sequence
Translation from 35 to 532
> IP06488.hyp
MSLNCPVHNKNSSGLNITRSATSDDVKIAMCACLELANCRAENCQLKKKL
TEYEAKICSLEQLVATIAEEQNQIRQEVIELRNETQGATMEAANEVDPLD
NSFVNPQEEMDDEEGYDPDSESEYNAIQSPNPSIHSSMVSLVRSLSFSST
SSDSDCIVYSDNEDF*
IP06488.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:43:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14384-PB | 165 | CG14384-PB | 1..165 | 1..165 | 847 | 100 | Plus |
CG14384-PA | 165 | CG14384-PA | 1..165 | 1..165 | 847 | 100 | Plus |
IP06488.pep Sequence
Translation from 35 to 532
> IP06488.pep
MSLNCPVHNKNSSGLNITRSATSDDVKIAMCACLELANCRAENCQLKKKL
TEYEAKICSLEQLVATIAEEQNQIRQEVIELRNETQGATMEAANEVDPLD
NSFVNPQEEMDDEEGYDPDSESEYNAIQSPNPSIHSSMVSLVRSLSFSST
SSDSDCIVYSDNEDF*
IP06488.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18093-PA | 210 | GF18093-PA | 1..133 | 1..132 | 288 | 51.1 | Plus |
Dana\GF11508-PA | 244 | GF11508-PA | 62..113 | 35..86 | 150 | 59.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14384-PB | 165 | CG14384-PB | 1..165 | 1..165 | 847 | 100 | Plus |
CG14384-PA | 165 | CG14384-PA | 1..165 | 1..165 | 847 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:03:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI18473-PA | 237 | GI18473-PA | 40..109 | 16..86 | 138 | 40.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:03:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL23155-PA | 188 | GL23155-PA | 1..86 | 1..86 | 135 | 41.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:03:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12948-PA | 185 | GA12948-PA | 1..163 | 1..155 | 147 | 34.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:03:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20532-PA | 175 | GD20532-PA | 1..175 | 1..165 | 675 | 78.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:03:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ21332-PA | 209 | GJ21332-PA | 5..67 | 23..86 | 143 | 50 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:03:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK10858-PA | 127 | GK10858-PA | 1..86 | 28..117 | 138 | 44.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:03:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11384-PA | 126 | GE11384-PA | 25..76 | 35..86 | 141 | 57.7 | Plus |