Clone IP06488 Report

Search the DGRC for IP06488

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:64
Well:88
Vector:pOT2
Associated Gene/TranscriptCG14384-RA
Protein status:IP06488.pep: gold
Preliminary Size:616
Sequenced Size:648

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14384 2005-01-01 Successful iPCR screen
CG14384 2008-04-29 Release 5.5 accounting
CG14384 2008-08-15 Release 5.9 accounting
CG14384 2008-12-18 5.12 accounting

Clone Sequence Records

IP06488.complete Sequence

648 bp (648 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023605

> IP06488.complete
CTAAACTGAACTGCCTATAAATTTCAAGTCTCAAAATGTCCCTCAATTGC
CCGGTTCATAATAAGAACTCCAGTGGCTTAAACATTACCAGGTCCGCAAC
CTCGGATGACGTCAAGATCGCCATGTGCGCCTGCTTGGAATTGGCCAACT
GTCGGGCCGAAAACTGTCAGCTGAAGAAGAAACTGACCGAATATGAGGCC
AAGATCTGCAGTCTCGAACAACTGGTGGCCACCATTGCGGAGGAGCAGAA
CCAGATTCGCCAAGAAGTGATCGAGTTGCGCAATGAGACTCAGGGTGCAA
CGATGGAAGCCGCCAACGAGGTGGATCCTTTGGACAACTCATTCGTGAAC
CCGCAAGAGGAAATGGACGATGAGGAAGGATACGATCCGGATTCAGAATC
CGAGTACAATGCTATCCAGTCCCCCAATCCCTCAATACATTCTTCGATGG
TCTCGCTGGTTCGCTCATTGAGTTTTTCATCCACCAGCTCAGATTCTGAT
TGCATTGTATACAGCGATAATGAGGATTTCTAAGAAACCCATCTCATTCC
AATCGCATCTTCTCAACAAGTTCCGTTCGCGAACTTTGATACCACACGAT
ATGAGTAAACGACAATGTTAAAATAAAAAAAAAAAAAAAAAAAAAAAA

IP06488.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG14384-RA 707 CG14384-RA 84..707 1..624 3120 100 Plus
Cyp304a1-RA 2025 Cyp304a1-RA 1985..2025 627..587 205 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8791176..8791718 624..82 2700 99.8 Minus
chr3R 27901430 chr3R 8791791..8791875 85..1 425 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12965935..12966480 627..82 2715 99.8 Minus
3R 32079331 3R 12966553..12966637 85..1 425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12706766..12707311 627..82 2715 99.8 Minus
3R 31820162 3R 12707384..12707468 85..1 425 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:38:51 has no hits.

IP06488.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:39:35 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8791176..8791714 86..624 100 <- Minus
chr3R 8791791..8791875 1..85 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:47 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 1..498 36..533 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:59 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 1..498 36..533 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:08 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 1..498 36..533 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:23 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 1..498 36..533 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:48 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 1..498 36..533 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:33 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 84..707 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:58 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 84..707 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:08 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 84..707 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:23 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 84..707 1..624 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:48 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14384-RA 84..707 1..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:35 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12966553..12966637 1..85 100   Minus
3R 12965938..12966476 86..624 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:35 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12966553..12966637 1..85 100   Minus
3R 12965938..12966476 86..624 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:35 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12966553..12966637 1..85 100   Minus
3R 12965938..12966476 86..624 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:08 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8791660..8792198 86..624 100 <- Minus
arm_3R 8792275..8792359 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:58 Download gff for IP06488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12706769..12707307 86..624 100 <- Minus
3R 12707384..12707468 1..85 100   Minus

IP06488.hyp Sequence

Translation from 35 to 532

> IP06488.hyp
MSLNCPVHNKNSSGLNITRSATSDDVKIAMCACLELANCRAENCQLKKKL
TEYEAKICSLEQLVATIAEEQNQIRQEVIELRNETQGATMEAANEVDPLD
NSFVNPQEEMDDEEGYDPDSESEYNAIQSPNPSIHSSMVSLVRSLSFSST
SSDSDCIVYSDNEDF*

IP06488.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14384-PB 165 CG14384-PB 1..165 1..165 847 100 Plus
CG14384-PA 165 CG14384-PA 1..165 1..165 847 100 Plus

IP06488.pep Sequence

Translation from 35 to 532

> IP06488.pep
MSLNCPVHNKNSSGLNITRSATSDDVKIAMCACLELANCRAENCQLKKKL
TEYEAKICSLEQLVATIAEEQNQIRQEVIELRNETQGATMEAANEVDPLD
NSFVNPQEEMDDEEGYDPDSESEYNAIQSPNPSIHSSMVSLVRSLSFSST
SSDSDCIVYSDNEDF*

IP06488.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18093-PA 210 GF18093-PA 1..133 1..132 288 51.1 Plus
Dana\GF11508-PA 244 GF11508-PA 62..113 35..86 150 59.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14384-PB 165 CG14384-PB 1..165 1..165 847 100 Plus
CG14384-PA 165 CG14384-PA 1..165 1..165 847 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18473-PA 237 GI18473-PA 40..109 16..86 138 40.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23155-PA 188 GL23155-PA 1..86 1..86 135 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12948-PA 185 GA12948-PA 1..163 1..155 147 34.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20532-PA 175 GD20532-PA 1..175 1..165 675 78.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21332-PA 209 GJ21332-PA 5..67 23..86 143 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10858-PA 127 GK10858-PA 1..86 28..117 138 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11384-PA 126 GE11384-PA 25..76 35..86 141 57.7 Plus