Clone IP06517 Report

Search the DGRC for IP06517

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:65
Well:17
Vector:pOT2
Associated Gene/TranscriptCG12426-RB
Protein status:IP06517.pep: gold
Preliminary Size:564
Sequenced Size:674

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12426 2005-01-01 Successful iPCR screen
CG12426 2008-04-29 Release 5.5 accounting
CG12426 2008-08-15 Release 5.9 accounting
CG12426 2008-12-18 5.12 accounting

Clone Sequence Records

IP06517.complete Sequence

674 bp (674 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022542

> IP06517.complete
ATTTGCTTTTACTGTCAATGCTTTGAACAAAATTTCTGGTTACCATTATG
AGCTTCCCCTTTCGTTTGGTGAACTTTGTGCTGCAGTTGCTAACGGCGGT
CCTGGAGGTTGTGGCCCTGGGTCTGCTCATCCGAATCCTATCCACGCACT
GTGTCCTGGGCGAGGAGTACGGCATATCGGTGTGGATGTACACGTTCATC
CTACCCGCCATCGCCTGTCAGAGCGTGGTTCTCGTCATATTCCGGCTATG
CTGCACCACCGTGGGCCTCGATCCAATTGCGATGACGTTTAATTTCGCCA
GCGGCTTCCTGTGCCTAGGAAGCGCACTTGCCCTCCTGGTGTCCATGGTC
GATCATTGCGGCAACGAGTTCGCATACATATTCTATATGTCGAGCGCCTT
TGGCGTAATCGCTGGGGTCCTGCATTTGCTGAATGCCTGCGTGTGCAACG
TTTACATTCCCAGCGGCGAATGGTCTTACATGAAACCTTCGAAGAGGGCA
AGGAAAAAGGAGTTGAAAAATCCTAGACGCAGAAGCTAGTGATGCGTACT
GGATGTTTGTACATATCTTAAGGATATCATTTATTGGTTGTATTACTGTT
TTTTTTTTTTTTACTTAGCTATCCTATATTAAATTTATAGTTGTTTCTTA
AAAAAAAAAAAAAAAAAAAAAAAA

IP06517.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12426-RB 666 CG12426-RB 4..653 1..650 3250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23694678..23694873 474..279 980 100 Minus
chr3R 27901430 chr3R 23694986..23695167 279..98 895 99.5 Minus
chr3R 27901430 chr3R 23694438..23694615 649..472 890 100 Minus
chr3R 27901430 chr3R 23695228..23695327 100..1 485 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27871741..27871936 474..279 980 100 Minus
3R 32079331 3R 27872049..27872230 279..98 910 100 Minus
3R 32079331 3R 27871500..27871678 650..472 895 100 Minus
3R 32079331 3R 27872291..27872390 100..1 500 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27612572..27612767 474..279 980 100 Minus
3R 31820162 3R 27612880..27613061 279..98 910 100 Minus
3R 31820162 3R 27612331..27612509 650..472 895 100 Minus
3R 31820162 3R 27613122..27613221 100..1 500 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:25:20 has no hits.

IP06517.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:26:07 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23694438..23694614 473..649 100 <- Minus
chr3R 23694680..23694873 279..472 100 <- Minus
chr3R 23694987..23695166 99..278 99 <- Minus
chr3R 23695230..23695327 1..98 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:53 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..492 48..539 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:34 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..492 48..539 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:41 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..492 48..539 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:23 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RA 1..51 48..98 100 -> Plus
CG12426-RA 115..496 99..481 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:07 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..492 48..539 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:01:15 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:34 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:41 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:23 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RA 1..51 48..98 100 -> Plus
CG12426-RA 115..496 99..481 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:07 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12426-RB 1..649 1..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:07 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27872293..27872390 1..98 100   Minus
3R 27871501..27871677 473..649 100 <- Minus
3R 27871743..27871936 279..472 100 <- Minus
3R 27872050..27872229 99..278 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:07 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27872293..27872390 1..98 100   Minus
3R 27871501..27871677 473..649 100 <- Minus
3R 27871743..27871936 279..472 100 <- Minus
3R 27872050..27872229 99..278 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:26:07 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27872293..27872390 1..98 100   Minus
3R 27871501..27871677 473..649 100 <- Minus
3R 27871743..27871936 279..472 100 <- Minus
3R 27872050..27872229 99..278 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:41 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23697223..23697399 473..649 100 <- Minus
arm_3R 23697465..23697658 279..472 100 <- Minus
arm_3R 23697772..23697951 99..278 100 <- Minus
arm_3R 23698015..23698112 1..98 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:30 Download gff for IP06517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27612332..27612508 473..649 100 <- Minus
3R 27612574..27612767 279..472 100 <- Minus
3R 27612881..27613060 99..278 100 <- Minus
3R 27613124..27613221 1..98 100   Minus

IP06517.hyp Sequence

Translation from 47 to 538

> IP06517.hyp
MSFPFRLVNFVLQLLTAVLEVVALGLLIRILSTHCVLGEEYGISVWMYTF
ILPAIACQSVVLVIFRLCCTTVGLDPIAMTFNFASGFLCLGSALALLVSM
VDHCGNEFAYIFYMSSAFGVIAGVLHLLNACVCNVYIPSGEWSYMKPSKR
ARKKELKNPRRRS*

IP06517.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG12426-PB 163 CG12426-PB 1..163 1..163 845 100 Plus

IP06517.pep Sequence

Translation from 47 to 538

> IP06517.pep
MSFPFRLVNFVLQLLTAVLEVVALGLLIRILSTHCVLGEEYGISVWMYTF
ILPAIACQSVVLVIFRLCCTTVGLDPIAMTFNFASGFLCLGSALALLVSM
VDHCGNEFAYIFYMSSAFGVIAGVLHLLNACVCNVYIPSGEWSYMKPSKR
ARKKELKNPRRRS*

IP06517.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18684-PA 165 GF18684-PA 1..164 1..163 439 53.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12088-PA 164 GG12088-PA 1..163 1..163 815 94.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16917-PA 166 GH16917-PA 3..139 5..141 349 51.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12426-PB 163 CG12426-PB 1..163 1..163 845 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16937-PA 167 GI16937-PA 2..125 18..141 258 41.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13760-PA 165 GL13760-PA 7..155 6..154 472 57 Plus
Dper\GL22711-PA 166 GL22711-PA 7..155 6..154 468 57.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26784-PA 165 GA26784-PA 7..155 6..154 472 57 Plus
Dpse\GA25516-PA 126 GA25516-PA 2..114 30..142 347 54.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16318-PA 166 GM16318-PA 1..142 1..142 714 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18054-PA 177 GD18054-PA 1..142 1..142 718 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10676-PA 156 GJ10676-PA 1..154 1..154 401 46.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11316-PA 161 GK11316-PA 1..154 1..154 556 64.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10536-PA 175 GE10536-PA 1..175 1..163 776 86.3 Plus