Clone IP06524 Report

Search the DGRC for IP06524

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:65
Well:24
Vector:pOT2
Associated Gene/TranscriptCG12811-RA
Protein status:IP06524.pep: gold
Preliminary Size:612
Sequenced Size:795

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12811 2005-01-01 Successful iPCR screen
CG12811 2008-04-29 Release 5.5 accounting
CG12811 2008-08-15 Release 5.9 accounting
CG12811 2008-12-18 5.12 accounting

Clone Sequence Records

IP06524.complete Sequence

795 bp (795 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025825

> IP06524.complete
AGTATCACATGAACAAGTGATTATACGGACAATGATCAATCCCCAACTTT
TGCTGATCGCCGCGCTTATTGCGTTTATTGGGAAAGTGGCACACGCTCAA
ATCGCCTTTGTTGAGGATCAAGACATTGATAAGAAGAAGGCCAACCTTGC
GGGTCGCAAGCCACTGTATTCGCCAGCCCGATGCCCCAAGCACCAGCTTC
TTTATCCGGGGGACCAGCAGAAGCAGAACGACTGGGTTTGCGACTGCGCG
CCAGCCACACTGTATTACCCGGAGACCGATGGCTGCTATCCGGCCTACCG
ACAGGGACCCTGTGAGGCTGGACAGATTCTGGTGCTCTACAAGGAGGAGA
TCATCCCGAAGTGCGTACGAAATCCATGTAACAGGGACGGACACTTTATG
ATTCGCGACACATGCTATGAGTTCGGAAACACCAAGAAGGAAGAAAACCC
GTGTCCTTACCAGGAGGCTTCCTTTGTACTTGGCGTGAATCCCACCAACT
TGATGGTGGACTGTGTGAAGCTGTCCGTTCAACTGGAGACGCGTATTTCG
GACACGGAGCAGGCTCCGCCGGAATACTACGTTGATTTGGCCGAGAAATG
CGCACGCGGCAGTCGCCTAATGGCTCAGGGAAAGTGTCCTTAAAGGATTT
TAACATTATGTGCTTAAATGTATTGTGTTCTGTTTGGTAATGTGTGGAGG
CCAGTGAAGAATAGCGAATTTGTTCCATGTTTAAGACAGATATAATATGA
TTACATACCATTTCTCAAAATGAAAAAAAAAAAAAAAAAAAAAAA

IP06524.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12811-RA 1029 CG12811-RA 256..1029 1..774 3870 100 Plus
CG12811.a 1029 CG12811.a 256..1029 1..774 3870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5873021..5873540 772..253 2600 100 Minus
chr3R 27901430 chr3R 5874185..5874336 152..1 760 100 Minus
chr3R 27901430 chr3R 5873610..5873713 254..151 520 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10047250..10047771 774..253 2610 100 Minus
3R 32079331 3R 10048416..10048567 152..1 760 100 Minus
3R 32079331 3R 10047841..10047944 254..151 520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9788081..9788602 774..253 2610 100 Minus
3R 31820162 3R 9789247..9789398 152..1 760 100 Minus
3R 31820162 3R 9788672..9788775 254..151 520 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:28:48 has no hits.

IP06524.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:29:45 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5874186..5874336 1..151 100   Minus
chr3R 5873021..5873538 255..772 100 <- Minus
chr3R 5873610..5873712 152..254 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:54 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..612 32..643 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:29:51 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..612 32..643 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:02 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..612 32..643 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:00:10 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..612 32..643 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:52 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..612 32..643 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:01:20 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..612 32..643 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:29:51 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..772 1..772 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:02 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 231..1002 1..772 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:00:11 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 1..612 32..643 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:52 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
CG12811-RA 231..1002 1..772 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:45 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10048417..10048567 1..151 100   Minus
3R 10047252..10047769 255..772 100 <- Minus
3R 10047841..10047943 152..254 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:45 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10048417..10048567 1..151 100   Minus
3R 10047252..10047769 255..772 100 <- Minus
3R 10047841..10047943 152..254 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:29:45 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10048417..10048567 1..151 100   Minus
3R 10047252..10047769 255..772 100 <- Minus
3R 10047841..10047943 152..254 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:02 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5872974..5873491 255..772 100 <- Minus
arm_3R 5873563..5873665 152..254 100 <- Minus
arm_3R 5874139..5874289 1..151 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:55:44 Download gff for IP06524.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9788083..9788600 255..772 100 <- Minus
3R 9788672..9788774 152..254 100 <- Minus
3R 9789248..9789398 1..151 100   Minus

IP06524.hyp Sequence

Translation from 0 to 642

> IP06524.hyp
VSHEQVIIRTMINPQLLLIAALIAFIGKVAHAQIAFVEDQDIDKKKANLA
GRKPLYSPARCPKHQLLYPGDQQKQNDWVCDCAPATLYYPETDGCYPAYR
QGPCEAGQILVLYKEEIIPKCVRNPCNRDGHFMIRDTCYEFGNTKKEENP
CPYQEASFVLGVNPTNLMVDCVKLSVQLETRISDTEQAPPEYYVDLAEKC
ARGSRLMAQGKCP*

IP06524.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12811-PA 203 CG12811-PA 1..203 11..213 1109 100 Plus

IP06524.pep Sequence

Translation from 31 to 642

> IP06524.pep
MINPQLLLIAALIAFIGKVAHAQIAFVEDQDIDKKKANLAGRKPLYSPAR
CPKHQLLYPGDQQKQNDWVCDCAPATLYYPETDGCYPAYRQGPCEAGQIL
VLYKEEIIPKCVRNPCNRDGHFMIRDTCYEFGNTKKEENPCPYQEASFVL
GVNPTNLMVDCVKLSVQLETRISDTEQAPPEYYVDLAEKCARGSRLMAQG
KCP*

IP06524.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17138-PA 202 GF17138-PA 1..201 1..202 884 80.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17307-PA 205 GG17307-PA 4..205 2..203 996 91.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17899-PA 202 GH17899-PA 1..198 1..202 679 60.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12811-PA 203 CG12811-PA 1..203 1..203 1109 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24448-PA 208 GI24448-PA 1..204 1..202 727 64.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27282-PA 201 GL27282-PA 1..200 1..202 844 78.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11824-PA 201 GA11824-PA 1..200 1..202 842 78.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26191-PA 203 GM26191-PA 1..203 1..203 1061 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20740-PA 195 GD20740-PA 1..186 1..186 969 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10725-PA 208 GJ10725-PA 1..204 1..202 725 65 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22663-PA 187 GK22663-PA 1..187 19..203 801 78.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24710-PA 203 GE24710-PA 1..203 1..203 1006 91.1 Plus