Clone IP06556 Report

Search the DGRC for IP06556

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:65
Well:56
Vector:pOT2
Associated Gene/TranscriptCG13541-RA
Protein status:IP06556.pep: gold
Preliminary Size:519
Sequenced Size:950

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13541 2005-01-01 Successful iPCR screen
CG13541 2008-04-29 Release 5.5 accounting
CG13541 2008-12-18 5.12 accounting

Clone Sequence Records

IP06556.complete Sequence

950 bp (950 high quality bases) assembled on 2006-06-06

GenBank Submission: BT025909

> IP06556.complete
ATTACTTGTTATCACATCGAGTAAATGGGACGCAAAGGCCACAAGACTAG
AAGGAAAGTTAAAGTCCACTCGAAGGTCCATCCTCCTCAGAAAATTAAAG
CGAAGCTGCCGAAAAGAGATAAACGTAGCACACTTCGTCCCAAGATTAAT
AATTCGAAGGTTTTTCACGTGAACTGCTGCAAGTACAAGATCCGTTCGAG
ACCCATGAGGCGCAATCAGTGCAACCTGGCCACCCAGTGCCCCTCCCACA
CGGTCGCCATCGCCCCGTCTGTGCCGCTCCTGCATCATCCTGTCCGGCGG
AAGGTGGTCCATATGCCGGAAACCGTGGTCATGCACATGCGGAATATGGA
GGACGCCCGCCGAGTGGCGGTTAAGCACAGAAGAACCCTTATTCAAACCC
ATGTTCCTTCGCCGGATGTGGATGATGACGAAGATACACACCAAATCGAT
CGGAGGTCAAGGCAAGCCTATAGGATGGGTCAAATGAGACCCTTATCCAG
CGACGTGGATGTGGATGACATGGATGTGGACCCGTTTCAGTAGGGATGTG
TGTTGGAAATATATTGTAGTTGCCAATCCACATATCCCGTGAGACGAGGG
ATTCCATTGCCACTTCTAACTAGTTGCTTCGCCCCATGGGCATATCGTGA
TCATCCATAAAACCACGCCCCTCCGCCAGTCTCCCCAAGCCCAACCAAGC
TGTCCAGGACAATTAATTTTACACCGGCTTGTCAGCTTATTGTTTATCTA
CATAACTACGGAACACGGAGAACAGAGAACAGAGGACGACTGCCCTGAGC
TGTCGTGTCATTTATTCAGCTGCTCCGACCGGGCTCGACTTTCGATATCC
TTTGGGCCGCGGTGCAGTTGCCACACCATTTATGCCATTAAGTCATTAGC
TTTGTTTAACAAATAACAAACTGTCAATGAGTGAAAAAAAAAAAAAAAAA

IP06556.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13541.a 1545 CG13541.a 67..1000 1..934 4670 100 Plus
CG13541-RA 1033 CG13541-RA 67..1000 1..934 4670 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19170667..19171235 1..569 2785 99.3 Plus
chr2R 21145070 chr2R 19171296..19171662 567..933 1805 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23284280..23284848 1..569 2845 100 Plus
2R 25286936 2R 23284909..23285276 567..934 1840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23285479..23286047 1..569 2845 100 Plus
2R 25260384 2R 23286108..23286475 567..934 1840 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:54:43 has no hits.

IP06556.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:55:33 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19170667..19171235 1..569 99 -> Plus
chr2R 19171299..19171662 570..933 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:29:59 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..519 25..543 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:23:10 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..519 25..543 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:12 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..519 25..543 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:41:45 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..519 25..543 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:03:33 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..519 25..543 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:51:21 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..933 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:23:09 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..933 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:12 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 54..986 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:41:45 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 1..519 25..543 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:03:33 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
CG13541-RA 54..986 1..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:33 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23284280..23284848 1..569 100 -> Plus
2R 23284912..23285275 570..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:33 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23284280..23284848 1..569 100 -> Plus
2R 23284912..23285275 570..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:33 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23284280..23284848 1..569 100 -> Plus
2R 23284912..23285275 570..933 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:12 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19171803..19172371 1..569 100 -> Plus
arm_2R 19172435..19172798 570..933 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:12 Download gff for IP06556.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23285497..23286065 1..569 100 -> Plus
2R 23286129..23286492 570..933 100   Plus

IP06556.hyp Sequence

Translation from 24 to 542

> IP06556.hyp
MGRKGHKTRRKVKVHSKVHPPQKIKAKLPKRDKRSTLRPKINNSKVFHVN
CCKYKIRSRPMRRNQCNLATQCPSHTVAIAPSVPLLHHPVRRKVVHMPET
VVMHMRNMEDARRVAVKHRRTLIQTHVPSPDVDDDEDTHQIDRRSRQAYR
MGQMRPLSSDVDVDDMDVDPFQ*

IP06556.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13541-PB 172 CG13541-PB 1..172 1..172 920 100 Plus
CG13541-PA 172 CG13541-PA 1..172 1..172 920 100 Plus

IP06556.pep Sequence

Translation from 24 to 542

> IP06556.pep
MGRKGHKTRRKVKVHSKVHPPQKIKAKLPKRDKRSTLRPKINNSKVFHVN
CCKYKIRSRPMRRNQCNLATQCPSHTVAIAPSVPLLHHPVRRKVVHMPET
VVMHMRNMEDARRVAVKHRRTLIQTHVPSPDVDDDEDTHQIDRRSRQAYR
MGQMRPLSSDVDVDDMDVDPFQ*

IP06556.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22838-PA 174 GG22838-PA 1..171 1..165 535 68.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13541-PB 172 CG13541-PB 1..172 1..172 920 100 Plus
CG13541-PA 172 CG13541-PA 1..172 1..172 920 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15995-PA 172 GM15995-PA 1..172 1..172 749 85.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11747-PA 172 GD11747-PA 1..172 1..172 720 86 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14273-PA 112 GE14273-PA 1..112 61..172 401 68.8 Plus