BDGP Sequence Production Resources |
Search the DGRC for IP06563
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 65 |
Well: | 63 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13856-RA |
Protein status: | IP06563.pep: gold |
Preliminary Size: | 570 |
Sequenced Size: | 889 |
Gene | Date | Evidence |
---|---|---|
CG13856 | 2005-01-01 | Successful iPCR screen |
CG13856 | 2008-04-29 | Release 5.5 accounting |
CG13856 | 2008-08-15 | Release 5.9 accounting |
CG13856 | 2008-12-18 | 5.12 accounting |
889 bp (889 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023606
> IP06563.complete AAGCATCGGCAAAGCAGTGCGAGAAAACGCGAAAAGTGCATCTAAGACAT TCGCTGTAAAATTTCAATGATCCAACTATAAACGTGATAGAACGTGTGCC TAGCATTACGCATAAATTAATTTCCACAATCTAATGAAGTAAACATCTTT CGCTTGAAGGACACCGTGGCAATAAATTGTACAATCGGCAAATATAATTA AGGAAAATCACTAATCAACAAAGCCAACCGGCAGCTGCAGTCATAGCCAT TTAAAAATGTCGCCGTTGCTTCCACTGGCATCGCTAATCATCTTGGCCAA TTTGGTGGCATCTCGACCCTATTCCTATGGTCCACGGGCAGAAGCGCCTC CCACGAGATTGGCCAACCGGATTGTGGTGCAGTCACCCTCGCTGGACAAC TTGTATATGGACTACGTGGTCACATCGAAGCCGCTGAATCTGCGCAAGTA CAACAAGAACGGCAGTAAGACGAAAAAAACGAAAAAGGATTCGAAAATAT ATTACATACCCGTACCCCCACTGCCCTTCCGCCACATACCTGGCATCGGC TTGGATTATCAGCCGATGAAAATCAATCCCATCCTTCACGAGTCGGAGAG CACAACGAGAAAGACCACAACGGTTCGCCCACCGACGACGACGACATCTA GCCCCAATCTGGATCATCGGAATCCGAGCAAAGTACTTCGAGTGCAACAC CTCAAGGATTACTACTTCAATGGGCGCCCACATCGACTGCAGGTTGCCCA TGCTGATAAAAAGTCCGGTCTGACGGCCCTTAACCTGAAGTCCAACTTTT ATTATAACAAAAACATTATTTATTAGTACTGTTAGTTAGAAAATAATAAA AACAAAAGAAAAACTCTACAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13856-RA | 972 | CG13856-RA | 102..972 | 1..871 | 4355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 18226262..18226515 | 1..255 | 98 | -> | Plus |
chr3R | 18227982..18228595 | 256..869 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 1..570 | 257..826 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 1..570 | 257..826 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 1..570 | 257..826 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 1..570 | 257..826 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 1..570 | 257..826 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 75..943 | 1..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 75..943 | 1..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 75..943 | 1..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 75..943 | 1..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13856-RA | 75..943 | 1..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22402729..22402983 | 1..255 | 100 | -> | Plus |
3R | 22404446..22405059 | 256..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22402729..22402983 | 1..255 | 100 | -> | Plus |
3R | 22404446..22405059 | 256..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22402729..22402983 | 1..255 | 100 | -> | Plus |
3R | 22404446..22405059 | 256..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 18228451..18228705 | 1..255 | 100 | -> | Plus |
arm_3R | 18230168..18230781 | 256..869 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22143560..22143814 | 1..255 | 100 | -> | Plus |
3R | 22145277..22145890 | 256..869 | 100 | Plus |
Translation from 256 to 825
> IP06563.pep MSPLLPLASLIILANLVASRPYSYGPRAEAPPTRLANRIVVQSPSLDNLY MDYVVTSKPLNLRKYNKNGSKTKKTKKDSKIYYIPVPPLPFRHIPGIGLD YQPMKINPILHESESTTRKTTTVRPPTTTTSSPNLDHRNPSKVLRVQHLK DYYFNGRPHRLQVAHADKKSGLTALNLKSNFYYNKNIIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18445-PA | 188 | GF18445-PA | 15..188 | 15..189 | 675 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11130-PA | 188 | GG11130-PA | 1..188 | 1..189 | 930 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20395-PA | 208 | GH20395-PA | 51..208 | 37..189 | 478 | 66.2 | Plus |
Dgri\GH13355-PA | 208 | GH13355-PA | 51..208 | 37..189 | 478 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13856-PA | 189 | CG13856-PA | 1..189 | 1..189 | 992 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22382-PA | 238 | GI22382-PA | 70..238 | 25..189 | 441 | 67.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24211-PA | 274 | GL24211-PA | 105..274 | 35..189 | 566 | 74.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12574-PB | 221 | GA12574-PB | 52..221 | 35..189 | 554 | 73.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26428-PA | 189 | GM26428-PA | 1..189 | 1..189 | 957 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20945-PA | 189 | GD20945-PA | 1..189 | 1..189 | 961 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24415-PA | 217 | GJ24415-PA | 51..217 | 32..189 | 484 | 63.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14266-PA | 194 | GK14266-PA | 14..194 | 14..189 | 457 | 60.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10296-PA | 188 | GE10296-PA | 1..188 | 1..189 | 813 | 95.2 | Plus |
Translation from 256 to 825
> IP06563.hyp MSPLLPLASLIILANLVASRPYSYGPRAEAPPTRLANRIVVQSPSLDNLY MDYVVTSKPLNLRKYNKNGSKTKKTKKDSKIYYIPVPPLPFRHIPGIGLD YQPMKINPILHESESTTRKTTTVRPPTTTTSSPNLDHRNPSKVLRVQHLK DYYFNGRPHRLQVAHADKKSGLTALNLKSNFYYNKNIIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13856-PA | 189 | CG13856-PA | 1..189 | 1..189 | 992 | 100 | Plus |