Clone IP06570 Report

Search the DGRC for IP06570

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:65
Well:70
Vector:pOT2
Associated Gene/TranscriptIlp8-RB
Protein status:IP06570.pep: gold
Preliminary Size:600
Sequenced Size:888

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14059 2005-01-01 Successful iPCR screen
CG14059 2008-04-29 Release 5.5 accounting
CG14059 2008-08-15 Release 5.9 accounting
CG14059 2008-12-18 5.12 accounting

Clone Sequence Records

IP06570.complete Sequence

888 bp (888 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022550

> IP06570.complete
CCGCTCGTGATTATCAGGTAACGTCGATCGGACGGACGGGTTAACCATTC
AGCAAGTTAGCTCTGCAGCAAGTTTGCCCGCCAAAAGAAAACACGTATAC
GTAGTGTTGCAGCCAGAAAGGTGATCGACGTGCCTACTGATCTATTGATC
TATTGAGAATTGTGATCCTAGAACGCCACTAAAATGAGTTCAAAGTTGCA
TATGTGCCGCTGGATGCTGCTGGTCATCGGAGTCTGTTGCCTGATGGGCA
GCTCGTCGGGCAGCTTCTGCTCCCTGGAGCGGATGAAGAAGTTCGCGATG
GAGGCGTGCGAGCACCTCTTTCAGGCGGACGAGGGTGCCCGCCGCGACAG
AAGGTCCATCGAGTTCGCGCACCACCATCTGAATCGACTTGGATCCGGCA
AAACGCACAACAAGCATCACTACATCAGCCGAAGCAGCTATCCAATGGGT
GGCTACCTGAAGGTGACCCGGGAGCACTTCAATCGCCTCAGCGAACTGGA
CATCTTTCCGCGCTACAAGCCCATCAAGCCGCACCACGAAAAGAAGCATC
GCTTCAAGAGGGATCACTCGAGCAGGTCCTACAACAACATTCCCTACTGC
TGTCTAAACCAGTGCGAGGAGGAGTTCTTCTGCTAAGAGAGCTCCAGTGT
CATGCTCCATGCCCCACGCTCCAAGTCGGTGCCATCTGGTCAGAATCTTC
TGAATCCGTCCATAGTTATAGTTAGGCTATTCATGTACATTCTACAAGTC
GCGCTCACTCTTATAGAGTACCTTATTTGTGCCCACTCCCAGGGACACAG
ATCCATTTACAGTATTTATACACTTAGATCGATTTTGAATAAACAATCGA
ATACGGCAACTGATCGGAAAAAAAAAAAAAAAAAAAAA

IP06570.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14059-RB 1050 CG14059-RB 182..1050 1..869 4345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17019257..17019729 867..395 2365 100 Minus
chr3L 24539361 chr3L 17020152..17020352 394..194 975 99 Minus
chr3L 24539361 chr3L 17021329..17021523 195..1 930 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:48:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17029810..17030284 869..395 2375 100 Minus
3L 28110227 3L 17030709..17030909 394..194 1005 100 Minus
3L 28110227 3L 17031886..17032080 195..1 975 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17022910..17023384 869..395 2375 100 Minus
3L 28103327 3L 17023809..17024009 394..194 1005 100 Minus
3L 28103327 3L 17024986..17025180 195..1 975 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:54:49 has no hits.

IP06570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:55:35 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17021329..17021523 1..195 98   Minus
chr3L 17019257..17019729 395..867 100 <- Minus
chr3L 17020152..17020350 196..394 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:01 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG14059-RB 1..453 184..636 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:16 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG14059-RB 1..453 184..636 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:17 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp8-RB 1..453 184..636 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:07 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG14059-RB 1..453 184..636 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:03:39 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp8-RB 1..453 184..636 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:41 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG14059-RB 1..867 1..867 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:16 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG14059-RB 1..867 1..867 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:17 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp8-RB 1..867 1..867 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:07 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
CG14059-RB 1..867 1..867 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:03:39 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp8-RB 1..867 1..867 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:35 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17029812..17030284 395..867 100 <- Minus
3L 17030709..17030907 196..394 100 <- Minus
3L 17031886..17032080 1..195 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:35 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17029812..17030284 395..867 100 <- Minus
3L 17030709..17030907 196..394 100 <- Minus
3L 17031886..17032080 1..195 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:35 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17029812..17030284 395..867 100 <- Minus
3L 17030709..17030907 196..394 100 <- Minus
3L 17031886..17032080 1..195 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:17 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17022912..17023384 395..867 100 <- Minus
arm_3L 17023809..17024007 196..394 100 <- Minus
arm_3L 17024986..17025180 1..195 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:11 Download gff for IP06570.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17024986..17025180 1..195 100   Minus
3L 17022912..17023384 395..867 100 <- Minus
3L 17023809..17024007 196..394 100 <- Minus

IP06570.hyp Sequence

Translation from 183 to 635

> IP06570.hyp
MSSKLHMCRWMLLVIGVCCLMGSSSGSFCSLERMKKFAMEACEHLFQADE
GARRDRRSIEFAHHHLNRLGSGKTHNKHHYISRSSYPMGGYLKVTREHFN
RLSELDIFPRYKPIKPHHEKKHRFKRDHSSRSYNNIPYCCLNQCEEEFFC
*

IP06570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp8-PB 150 CG14059-PB 1..150 1..150 838 100 Plus

IP06570.pep Sequence

Translation from 183 to 635

> IP06570.pep
MSSKLHMCRWMLLVIGVCCLMGSSSGSFCSLERMKKFAMEACEHLFQADE
GARRDRRSIEFAHHHLNRLGSGKTHNKHHYISRSSYPMGGYLKVTREHFN
RLSELDIFPRYKPIKPHHEKKHRFKRDHSSRSYNNIPYCCLNQCEEEFFC
*

IP06570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24404-PA 150 GF24404-PA 1..150 1..150 658 76.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15833-PA 126 GG15833-PA 46..126 70..150 399 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15950-PA 148 GH15950-PA 1..148 1..150 452 57.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp8-PB 150 CG14059-PB 1..150 1..150 838 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16601-PA 142 GI16601-PA 10..142 13..150 379 55.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16065-PA 150 GL16065-PA 1..150 1..150 620 74 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12729-PA 206 GA12729-PA 61..206 5..150 608 74.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24352-PA 210 GM24352-PA 65..210 5..150 785 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12429-PA 140 GD12429-PA 1..137 1..137 708 97.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12854-PA 143 GJ12854-PA 10..143 13..150 380 53.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20431-PA 150 GK20431-PA 1..150 1..150 481 65.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22173-PA 201 GE22173-PA 56..201 5..150 713 90.4 Plus