Clone IP06580 Report

Search the DGRC for IP06580

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:65
Well:80
Vector:pOT2
Associated Gene/Transcriptms(3)K81-RA
Protein status:IP06580.pep: gold
Preliminary Size:555
Sequenced Size:631

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14251 2005-01-01 Successful iPCR screen
ms(3)K81 2008-04-29 Release 5.5 accounting
ms(3)K81 2008-08-15 Release 5.9 accounting
ms(3)K81 2008-12-18 5.12 accounting

Clone Sequence Records

IP06580.complete Sequence

631 bp assembled on 2006-11-09

GenBank Submission: BT022562

> IP06580.complete
CTAATGTCGGATTCGCCCCATGAGGAGCACCGCTTGTGCGGTCTGGGGAA
TCACACGCTGAGGTCCCCGTACCGCGTAATCAGAAATCCGCACCTGCTGA
AGTTTGGCCAGCTGATAAACTCGGAGCTGCGGTCTCAGCCACTGTGCCTC
TCGTGCTACACGCAACTGATCCAGCTCTACCGGCTGAAGAACAACAATGC
GAAGAGACACCTGGCAAATAGACAGGCAGCCAGTGCTATTCTCTCGAGGA
GCAGTAGTGAGAAATCTCATGAGTCCGCGGCTAGTGTGTCCACAACACAA
TCCTCGGAGGAGCAAGAATCAACCACTAGCGCAGCGCCGGCGGCGGCGGC
TCAAAGAGCAGGAAGCCAGTTGGTTGAGTCCAATTCTTCCGACGATACAC
TTTTCTCCGATGACTACGATCCCAGCTCGAATCTGAGTTTGAATGCCGTG
AATGGAACGCGGCTACCGAATGTCCAACCAATTCCGAAAAGGCGCCAGTT
TGTGCATCTAAATCGTGAAGCTATGGCCATTTATCTGGCGGGAACTACTG
GGGGATAATGTTTGTTTCATTTAGGATATTTTCATAAATTAAATTTGAAA
TAACACTGTTAAAAAAAAAAAAAAAAAAAAA

IP06580.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
ms(3)K81-RA 610 ms(3)K81-RA 1..610 1..610 3050 100 Plus
l(3)neo26-RB 1090 l(3)neo26-RB 561..649 408..496 205 82 Plus
l(3)neo26-RA 1152 l(3)neo26-RA 623..711 408..496 205 82 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22699081..22699690 1..610 3050 100 Plus
chr3L 24539361 chr3L 18811477..18811561 412..496 200 82.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26875953..26876563 1..611 3055 100 Plus
3L 28110227 3L 18821825..18821913 408..496 205 82 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26616784..26617394 1..611 3055 100 Plus
3L 28103327 3L 18814925..18815013 408..496 205 82 Plus
Blast to na_te.dros performed on 2019-03-15 16:09:01 has no hits.

IP06580.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:10:14 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22699081..22699690 1..610 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:09 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 1..555 4..558 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:54 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 1..555 4..558 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:53:49 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 1..555 4..558 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:34 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 1..555 4..558 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:52 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 1..555 4..558 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:13 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 1..555 4..558 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:54 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 102..711 1..610 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:49 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 102..711 1..610 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:35 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 1..555 4..558 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:52 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
ms(3)K81-RA 102..711 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:14 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26875953..26876562 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:14 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26875953..26876562 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:14 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26875953..26876562 1..610 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:49 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22701675..22702284 1..610 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:06 Download gff for IP06580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26616784..26617393 1..610 100   Plus

IP06580.hyp Sequence

Translation from 0 to 557

> IP06580.hyp
LMSDSPHEEHRLCGLGNHTLRSPYRVIRNPHLLKFGQLINSELRSQPLCL
SCYTQLIQLYRLKNNNAKRHLANRQAASAILSRSSSEKSHESAASVSTTQ
SSEEQESTTSAAPAAAAQRAGSQLVESNSSDDTLFSDDYDPSSNLSLNAV
NGTRLPNVQPIPKRRQFVHLNREAMAIYLAGTTGG*

IP06580.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
ms(3)K81-PA 184 CG14251-PA 1..184 2..185 933 100 Plus
HipHop-PB 221 CG6874-PB 11..221 9..185 396 45.8 Plus
HipHop-PA 221 CG6874-PA 11..221 9..185 396 45.8 Plus

IP06580.pep Sequence

Translation from 3 to 557

> IP06580.pep
MSDSPHEEHRLCGLGNHTLRSPYRVIRNPHLLKFGQLINSELRSQPLCLS
CYTQLIQLYRLKNNNAKRHLANRQAASAILSRSSSEKSHESAASVSTTQS
SEEQESTTSAAPAAAAQRAGSQLVESNSSDDTLFSDDYDPSSNLSLNAVN
GTRLPNVQPIPKRRQFVHLNREAMAIYLAGTTGG*

IP06580.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10272-PA 239 GF10272-PA 18..239 12..184 258 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\ms(3)K81-PA 184 GG11507-PA 1..184 1..184 740 87 Plus
Dere\GG13678-PA 225 GG13678-PA 8..225 5..184 394 43.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13489-PA 199 GH13489-PA 9..199 4..184 319 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
ms(3)K81-PA 184 CG14251-PA 1..184 1..184 933 100 Plus
HipHop-PB 221 CG6874-PB 11..221 8..184 396 45.8 Plus
HipHop-PA 221 CG6874-PA 11..221 8..184 396 45.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17239-PA 191 GI17239-PA 9..191 4..184 306 43.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24882-PA 225 GL24882-PA 13..225 8..184 341 41.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19922-PA 225 GA19922-PA 13..225 8..184 341 41.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\ms(3)K81-PA 183 GM10349-PA 1..183 1..184 826 93.5 Plus
Dsec\GM14992-PA 227 GM14992-PA 11..227 8..184 386 44.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ms(3)K81-PA 183 GD21311-PA 1..183 1..184 832 92.4 Plus
Dsim\GD14769-PA 227 GD14769-PA 11..227 8..184 370 43.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\hiphop-PA 197 GJ17998-PA 7..197 2..184 344 44.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15167-PA 173 GK15167-PA 14..173 7..184 219 42 Plus
Dwil\GK12110-PA 234 GK12110-PA 9..96 10..94 144 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\ms(3)K81-PA 175 GE23697-PA 1..175 1..184 691 78.4 Plus
Dyak\GE19974-PA 229 GE19974-PA 11..229 8..184 368 39.9 Plus