BDGP Sequence Production Resources |
Search the DGRC for IP06581
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 65 |
Well: | 81 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14286-RA |
Protein status: | IP06581.pep: gold |
Preliminary Size: | 603 |
Sequenced Size: | 760 |
Gene | Date | Evidence |
---|---|---|
CG14286 | 2005-01-01 | Successful iPCR screen |
CG14286 | 2008-04-29 | Release 5.5 accounting |
CG14286 | 2008-08-15 | Release 5.9 accounting |
CG14286 | 2008-12-18 | 5.12 accounting |
760 bp (760 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023603
> IP06581.complete AAACATTACATTTTTTAACCATGCACAAACGAAGAACCGCCAAATCGATT AATAAGCCACCGCCAATCCAGGGAGCAATCAAGAAGCCCACGCCGGTGGC AGAACCTCCGTCCATCGACGCCGACCTTGTCACCCAGTTCGAAGTGGAGC TCTGCTGGTGTGTGCAGCAGTTGCAAACTGCTCTCGACAGCGGAAAACTG GCGCAAAAAGTGGCCGAAGATACTGCCAAGAACATAAAGGTACTAACCAG TTCAACAGCGCCGCTCATCAGGAAGCGGCAGGTGATGAAGCTAGCCCTGG GCGACTACCGAGCGAAGATGCAGCAGGAGGAGCAGAAGTTGCTACTAGCC TCCAGGCAAATCAAATTCACACCTACGGCTGAATCATCCAAAAAGTCTAG CTTTGTAAAGAAGTCGGCGCTTCTGTCATCTGGAAAGGACTTCCGCTTCA ACTTTCCCTCGCCCGCCGAAGACACCAGCTCAAAAGAGCCTCAACCAGTC CAGGACTTCGATCCCAGCAGCCTTCAACCAGCTGAAGCCGGAAGTCCGTT CAAGTTCAACTTCACCATCGCGGAGGATTCGGCCAATGACATTAGTTTCA GCGGTCTGAACTTGAATAAGTAATCAATCACAAAAGCCTGAATGATCTTA GATTTTCTAATTCCTACTCTTTATACAAATAAAAAGCATTTAAATAAAAA CTCGTAGGCATAAATTTATGGCCATTCAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14286-RA | 762 | CG14286-RA | 36..762 | 1..727 | 3635 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14848110..14848836 | 1..727 | 3635 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 19024127..19024857 | 1..731 | 3655 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18764958..18765688 | 1..731 | 3655 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14848110..14848836 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 1..603 | 21..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 1..603 | 21..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 1..603 | 21..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 1..603 | 21..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 1..603 | 21..623 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 36..762 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 36..762 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 36..762 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 36..762 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14286-RA | 36..762 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19024127..19024853 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19024127..19024853 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19024127..19024853 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14849849..14850575 | 1..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18764958..18765684 | 1..727 | 100 | Plus |
Translation from 2 to 622
> IP06581.hyp TLHFLTMHKRRTAKSINKPPPIQGAIKKPTPVAEPPSIDADLVTQFEVEL CWCVQQLQTALDSGKLAQKVAEDTAKNIKVLTSSTAPLIRKRQVMKLALG DYRAKMQQEEQKLLLASRQIKFTPTAESSKKSSFVKKSALLSSGKDFRFN FPSPAEDTSSKEPQPVQDFDPSSLQPAEAGSPFKFNFTIAEDSANDISFS GLNLNK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14286-PA | 200 | CG14286-PA | 1..200 | 7..206 | 1010 | 100 | Plus |
Translation from 20 to 622
> IP06581.pep MHKRRTAKSINKPPPIQGAIKKPTPVAEPPSIDADLVTQFEVELCWCVQQ LQTALDSGKLAQKVAEDTAKNIKVLTSSTAPLIRKRQVMKLALGDYRAKM QQEEQKLLLASRQIKFTPTAESSKKSSFVKKSALLSSGKDFRFNFPSPAE DTSSKEPQPVQDFDPSSLQPAEAGSPFKFNFTIAEDSANDISFSGLNLNK *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23107-PA | 200 | GG23107-PA | 1..200 | 1..200 | 928 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12881-PA | 208 | GH12881-PA | 1..202 | 1..198 | 552 | 52.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14286-PA | 200 | CG14286-PA | 1..200 | 1..200 | 1010 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11205-PA | 201 | GI11205-PA | 1..200 | 1..199 | 580 | 60.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15818-PA | 215 | GL15818-PA | 1..214 | 1..199 | 670 | 63.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23362-PA | 158 | GA23362-PA | 54..157 | 109..199 | 258 | 58.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23263-PA | 200 | GM23263-PA | 1..200 | 1..200 | 1010 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19263-PA | 200 | GD19263-PA | 1..200 | 1..200 | 943 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18494-PA | 203 | GJ18494-PA | 1..202 | 1..199 | 605 | 60.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10158-PA | 219 | GK10158-PA | 1..218 | 1..199 | 616 | 60.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25574-PA | 200 | GE25574-PA | 1..200 | 1..200 | 860 | 87 | Plus |