Clone IP06583 Report

Search the DGRC for IP06583

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:65
Well:83
Vector:pOT2
Associated Gene/TranscriptCG14340
Protein status:IP06583.pep: Imported from assembly
Preliminary Size:597
Sequenced Size:998

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14340 2005-01-01 Successful iPCR screen
CG14340 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

IP06583.complete Sequence

998 bp assembled on 2011-03-11

GenBank Submission: BT126164.1

> IP06583.complete
CCCACGGAGGAGGCATCAGCTCGTTGGCCGGGCTGGAGGAGAAGCCAGCG
GCCTGTGTGGCCAGCAGCACGGCCTTGGCCATTAGGAACTCGACCATAAT
CGCCCATCGGCTGTCCATTTACCTGCCGCAGCTGCTGCTGCCCTCTCGGG
ATCCCCAGAAGCTCATTACCGAAATCAACTGCTACGTGGCCCAGTTTCGG
GAGCTGCTCATCTTTATTGGCCAGGCCCGCGATTCGCCAGAGCTGCGCGA
GAAGATCAGGAAGCTGAGGCGCAGCTGTGTGGATGCCTGCAAGCACACCG
CCCACTTAATCACTCCCCAGCCGCGCCACTGCCTGGGCAGCCCCAGTGAG
AGGATGCACTTGACCCTGCTCTACCACCTCACGTTGCAGTTCCAGCACGA
GTTGATCAAGAGCCATCGCTTGATCCAACTGGTGCCGCTGGACATGACGG
AGTACTATGCTCCTTCCCGCACTGCTCCATCCAATCTGGGCAATGTCATC
AGCCAATTCTTGCTGTGCAAGCAGATAAATCCCGATTTCCAGCAGGAGGA
GCTGTGCAGCATTGTCAAGGACTCGCAGGAGCTTAGCGAGCTCTTGGAGG
AGTTGCAGGCTCACATGCCCTTGACCGAGGCCTCTCCAGAATTCGACCTG
GATCCAACACAGAAATCTGAAAGTAGCCTTGTTTCCCTCAACACTCCGGA
TTGGTATGCCCGGCAGCGCAGAAGGAGTTGCAAGAGCCGGAGTCGTAGTC
TTTGTTGCTGCCTGGCCAGGAAGTCACACAAAACCTTTTAGAAGGAGCTA
GATACATAAATAGTTTGCTGTCTTTCAATGTTATATAGTGATAGTTTCCT
ATAAGCTCGGTGTCAAATGTCATGTAAAGGAAATGAAAACCTGTCCAACA
TAGAAGCCAACTATCAACTACGAACTAGCGATTTTACACCCATTAATAAG
TCAATAAATCTGTAAATGTTGCACTGTTCAAAAAAAAAAAAAAAAAAA

IP06583.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1113677..1113989 667..979 1535 99.4 Plus
chr2L 23010047 chr2L 1113053..1113352 160..459 1470 99.3 Plus
chr2L 23010047 chr2L 1113409..1113620 459..670 1015 98.6 Plus
chr2L 23010047 chr2L 1112843..1113003 1..161 805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1113826..1114140 667..981 1575 100 Plus
2L 23513712 2L 1113202..1113501 160..459 1500 100 Plus
2L 23513712 2L 1113558..1113769 459..670 1045 99.5 Plus
2L 23513712 2L 1112992..1113152 1..161 805 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1113826..1114140 667..981 1575 100 Plus
2L 23513712 2L 1113202..1113501 160..459 1500 100 Plus
2L 23513712 2L 1113558..1113769 459..670 1045 99.5 Plus
2L 23513712 2L 1112992..1113152 1..161 805 100 Plus
2L 23513712 2L 4719818..4719922 476..580 180 78 Plus
2L 23513712 2L 4712346..4712431 219..304 145 77.9 Plus
Blast to na_te.dros performed on 2019-03-16 22:31:43 has no hits.

IP06583.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:32:25 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1112843..1113003 1..161 100 -> Plus
chr2L 1113055..1113352 162..459 99 -> Plus
chr2L 1113410..1113616 460..666 99 -> Plus
chr2L 1113677..1113989 667..979 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:09 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
CG14340-RA 5..795 1..791 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:57:14 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
CG14340-RA 5..795 1..791 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:29:26 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
CG14340-RA 5..795 1..791 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:08 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
CG14340-RA 5..983 1..979 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:57:14 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
CG14340-RA 52..1030 1..979 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:26 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
CG14340-RA 52..1030 1..979 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:25 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1112992..1113152 1..161 100 -> Plus
2L 1113204..1113501 162..459 100 -> Plus
2L 1113559..1113765 460..666 100 -> Plus
2L 1113826..1114138 667..979 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:25 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1112992..1113152 1..161 100 -> Plus
2L 1113204..1113501 162..459 100 -> Plus
2L 1113559..1113765 460..666 100 -> Plus
2L 1113826..1114138 667..979 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:25 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1112992..1113152 1..161 100 -> Plus
2L 1113204..1113501 162..459 100 -> Plus
2L 1113559..1113765 460..666 100 -> Plus
2L 1113826..1114138 667..979 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:57:14 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1112992..1113152 1..161 100 -> Plus
arm_2L 1113204..1113501 162..459 100 -> Plus
arm_2L 1113559..1113765 460..666 100 -> Plus
arm_2L 1113826..1114138 667..979 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:21 Download gff for IP06583.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1113204..1113501 162..459 100 -> Plus
2L 1113559..1113765 460..666 100 -> Plus
2L 1113826..1114138 667..979 100   Plus
2L 1112992..1113152 1..161 100 -> Plus

IP06583.pep Sequence

Translation from 2 to 790

> IP06583.pep
HGGGISSLAGLEEKPAACVASSTALAIRNSTIIAHRLSIYLPQLLLPSRD
PQKLITEINCYVAQFRELLIFIGQARDSPELREKIRKLRRSCVDACKHTA
HLITPQPRHCLGSPSERMHLTLLYHLTLQFQHELIKSHRLIQLVPLDMTE
YYAPSRTAPSNLGNVISQFLLCKQINPDFQQEELCSIVKDSQELSELLEE
LQAHMPLTEASPEFDLDPTQKSESSLVSLNTPDWYARQRRRSCKSRSRSL
CCCLARKSHKTF*

IP06583.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15161-PA 265 GF15161-PA 7..265 2..262 1119 86.6 Plus
Dana\GF21398-PA 239 GF21398-PA 33..238 44..259 514 48.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24765-PA 265 GG24765-PA 3..265 1..262 1114 95.4 Plus
Dere\GG25016-PA 113 GG25016-PA 19..112 155..259 220 44.8 Plus
Dere\GG25015-PA 120 GG25015-PA 65..117 54..106 199 67.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11171-PA 261 GH11171-PA 1..236 5..235 900 76.7 Plus
Dgri\GH13136-PA 206 GH13136-PA 30..187 54..210 493 60.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14340-PA 264 CG14340-PA 3..264 1..262 1360 100 Plus
CG34351-PC 226 CG34351-PC 30..225 54..259 494 49.5 Plus
CG34351-PD 233 CG34351-PD 30..225 54..259 494 49.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17974-PA 271 GI17974-PA 1..271 5..262 889 69.7 Plus
Dmoj\GI22848-PA 188 GI22848-PA 30..187 54..259 367 41.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15518-PA 273 GL15518-PA 15..249 6..238 1049 86 Plus
Dper\GL14468-PA 113 GL14468-PA 19..112 155..259 222 45.7 Plus
Dper\GL14464-PA 42 GL14464-PA 1..39 68..106 147 69.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26067-PA 273 GA26067-PA 8..249 2..238 1062 85.1 Plus
Dpse\GA11284-PA 110 GA11284-PA 16..109 155..259 221 45.7 Plus
Dpse\GA13862-PA 42 GA13862-PA 1..39 68..106 147 69.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16791-PA 227 GM16791-PA 3..227 1..262 1089 83.2 Plus
Dsec\GM18488-PA 113 GM18488-PA 19..112 155..259 220 44.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23068-PA 229 GD23068-PA 3..229 1..262 1114 84 Plus
Dsim\GD23297-PA 113 GD23297-PA 19..112 155..259 220 44.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19486-PA 264 GJ19486-PA 11..242 12..238 766 72 Plus
Dvir\GJ23396-PA 226 GJ23396-PA 30..225 54..259 520 51.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24665-PA 228 GK24665-PA 16..228 13..223 887 79.9 Plus
Dwil\GK23755-PA 226 GK23755-PA 30..225 54..259 510 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17308-PA 229 GE17308-PA 3..229 1..262 1118 83.6 Plus
Dyak\GE18304-PA 112 GE18304-PA 18..111 155..259 220 44.8 Plus
Dyak\GE17978-PA 56 GE17978-PA 1..55 54..108 195 65.5 Plus

IP06583.hyp Sequence

Translation from 2 to 790

> IP06583.hyp
HGGGISSLAGLEEKPAACVASSTALAIRNSTIIAHRLSIYLPQLLLPSRD
PQKLITEINCYVAQFRELLIFIGQARDSPELREKIRKLRRSCVDACKHTA
HLITPQPRHCLGSPSERMHLTLLYHLTLQFQHELIKSHRLIQLVPLDMTE
YYAPSRTAPSNLGNVISQFLLCKQINPDFQQEELCSIVKDSQELSELLEE
LQAHMPLTEASPEFDLDPTQKSESSLVSLNTPDWYARQRRRSCKSRSRSL
CCCLARKSHKTF*

IP06583.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14340-PA 264 CG14340-PA 3..264 1..262 1360 100 Plus
CG34351-PC 226 CG34351-PC 30..225 54..259 494 49.5 Plus
CG34351-PD 233 CG34351-PD 30..225 54..259 494 49.5 Plus