Clone IP06589 Report

Search the DGRC for IP06589

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:65
Well:89
Vector:pOT2
Associated Gene/TranscriptCG14455-RB
Protein status:IP06589.pep: gold
Preliminary Size:603
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14455 2005-01-01 Successful iPCR screen
CG14455 2008-04-29 Release 5.5 accounting
CG14455 2008-08-15 Release 5.9 accounting
CG14455 2008-12-18 5.12 accounting

Clone Sequence Records

IP06589.complete Sequence

696 bp (696 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022566

> IP06589.complete
CAAGATGCGTAAGGAGGTCATCCGAAGCTGCTGTGCCGTGGCCTTCATTT
TGGTGGCTCTCATGCCCTTGACTGGAGCGTGGCGCTCTTTCAAGGTCATC
CTCACGAGCATTGACTTTGAGGCCAACGACAAGTTCCTGGACCTTAAGGT
CGATCTGCAAAACGATTCGGGCGAGTCAAATCTGAGCATCGATATAAAGA
CGCACCAGGACATAGAGGACGTTCAGCTGGTGGTAGACTTTGGTTTGGAG
ACGGACAAGGGCAACTACTCTACCCTGATAAACCGTACGCTCAACTTCTG
CAAGCTGATGAAGCAGCGCAACTCGGATCCGCTGGTGCGCGCGATCTACG
AGGACCTTCTCAAGCACGGCACCCTCTTCAAGGAGTGCCCAATCCGGAGC
GGCACCTACAGCCTAACCAACTACAATGTGGACGAGGAGATGCTGCCCAG
CTTCCTGCCGGAGGCTAAGTTCCGCTTCGGCATGAAAATTTCGACGGACA
AGGGCGGCATGATCGTACGGTCGACCATCTTCGGCCGCATCGACAAGTCC
AAAGGCTTCGACAACCTGAAGCGGTTCAGTCTCGGCTAAGATACATATAC
CTCGCATGTTCCTCATGGTATCTCCTGCCCGCAGGAGATCCAATAAAGTT
TTGATGCGCGTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP06589.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14455-RA 713 CG14455-RA 49..713 1..665 3325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22675264..22675845 663..82 2910 100 Minus
chr3L 24539361 chr3L 22675910..22675991 82..1 410 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22686358..22686941 665..82 2920 100 Minus
3L 28110227 3L 22687006..22687087 82..1 410 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22679458..22680041 665..82 2920 100 Minus
3L 28103327 3L 22680106..22680187 82..1 410 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:59:27 has no hits.

IP06589.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:00:33 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22675264..22675844 83..663 100 <- Minus
chr3L 22675910..22675991 1..82 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:13 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RA 15..603 1..589 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:24 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RA 15..603 1..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:05:53 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RB 1..585 5..589 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:14 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RA 15..603 1..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:25:27 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RB 1..585 5..589 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:56 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RA 15..677 1..663 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:24 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RA 15..677 1..663 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:05:53 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RB 1..663 1..663 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:14 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RA 15..677 1..663 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:25:27 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14455-RB 1..663 1..663 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:33 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22686360..22686940 83..663 100 <- Minus
3L 22687006..22687087 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:33 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22686360..22686940 83..663 100 <- Minus
3L 22687006..22687087 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:00:33 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22686360..22686940 83..663 100 <- Minus
3L 22687006..22687087 1..82 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:05:53 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22679460..22680040 83..663 100 <- Minus
arm_3L 22680106..22680187 1..82 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:19 Download gff for IP06589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22680106..22680187 1..82 100   Minus
3L 22679460..22680040 83..663 100 <- Minus

IP06589.hyp Sequence

Translation from 0 to 588

> IP06589.hyp
KMRKEVIRSCCAVAFILVALMPLTGAWRSFKVILTSIDFEANDKFLDLKV
DLQNDSGESNLSIDIKTHQDIEDVQLVVDFGLETDKGNYSTLINRTLNFC
KLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTNYNVDEEMLPS
FLPEAKFRFGMKISTDKGGMIVRSTIFGRIDKSKGFDNLKRFSLG*

IP06589.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14455-PB 194 CG14455-PB 1..194 2..195 998 100 Plus
CG14456-PA 198 CG14456-PA 11..187 16..190 171 26.1 Plus
CG14456-PB 213 CG14456-PB 11..202 16..190 145 24.1 Plus

IP06589.pep Sequence

Translation from 1 to 588

> IP06589.pep
KMRKEVIRSCCAVAFILVALMPLTGAWRSFKVILTSIDFEANDKFLDLKV
DLQNDSGESNLSIDIKTHQDIEDVQLVVDFGLETDKGNYSTLINRTLNFC
KLMKQRNSDPLVRAIYEDLLKHGTLFKECPIRSGTYSLTNYNVDEEMLPS
FLPEAKFRFGMKISTDKGGMIVRSTIFGRIDKSKGFDNLKRFSLG*

IP06589.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23456-PA 194 GF23456-PA 1..194 2..195 724 67 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13177-PA 194 GG13177-PA 1..194 2..195 867 80.4 Plus
Dere\GG16270-PA 198 GG16270-PA 6..152 14..158 148 24.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14810-PA 179 GH14810-PA 1..179 16..195 493 49.4 Plus
Dgri\GH16707-PA 198 GH16707-PA 8..152 13..158 144 25.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14455-PB 194 CG14455-PB 1..194 2..195 998 100 Plus
CG14456-PA 198 CG14456-PA 11..187 16..190 171 26.1 Plus
CG14456-PB 213 CG14456-PB 11..202 16..190 145 24.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13914-PA 193 GI13914-PA 1..193 2..195 515 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12997-PA 204 GA12997-PA 31..204 22..195 660 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22088-PA 194 GM22088-PA 1..194 2..195 999 97.4 Plus
Dsec\GM22461-PA 198 GM22461-PA 11..187 16..190 151 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12063-PA 194 GD12063-PA 1..194 2..195 1005 97.9 Plus
Dsim\GD15044-PA 198 GD15044-PA 11..187 16..190 151 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13705-PA 193 GJ13705-PA 1..193 2..195 532 47.4 Plus
Dvir\GJ11651-PA 198 GJ11651-PA 11..151 16..157 145 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17449-PA 198 GK17449-PA 8..198 4..195 579 52.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19500-PA 194 GE19500-PA 1..194 2..195 928 89.2 Plus
Dyak\GE22628-PA 198 GE22628-PA 11..187 16..190 151 24.4 Plus