Clone IP06605 Report

Search the DGRC for IP06605

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:66
Well:5
Vector:pOT2
Associated Gene/TranscriptCG11110-RA
Protein status:IP06605.pep: gold
Preliminary Size:551
Sequenced Size:740

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11110 2005-01-01 Successful iPCR screen
CG11110 2008-04-29 Release 5.5 accounting
CG11110 2008-08-15 Release 5.9 accounting
CG11110 2008-12-18 5.12 accounting

Clone Sequence Records

IP06605.complete Sequence

740 bp assembled on 2006-11-09

GenBank Submission: BT023604

> IP06605.complete
ACTCGGCAAAAGGCTGGTGGTTATGTATTCATCTCGATAGCTCCGCTCTC
CAACCAGTTCATCCATGGCATTTCGGTTCTTTGGCAAGTCCTTGCTGTAC
GCTCTGCCACTTGGCGTCACTTTCCTGGACTGCGTTGGTTATGTGGCCAG
GGTGGATGGCATCTCCATGCAGCCCGCTCTCAATCCCGTGCCGGATGAAA
AGGACTATGTGTTCCTGCTGCGCTGGGGCACCCACAACAGTCAGGTGGAG
CGCGGCGACATAATATCGCTCATTTCACCCAAGGATCCCGCCCAGAAGAT
TATCAAGCGCGTGGTGGGGCTGCAGGGCGACGTCGTGTCCACGCTGGGCT
ACAAGCACGAGATCGTTCGCGTACCCGAAGGACATTGTTGGGTGGAGGGC
GATCACACAGGCCACTCCATGGACAGCAATACCTTTGGACCCGTCGCCCT
GGGCCTGATGTCCGCGCGGGCAGTGGCCATCGTGTGGCCACCGGAACGCT
GGCGAATACTGGAGAACGAACTGCCGCGGCGACGGAGACCCATACAGGCC
TCCAAGAACTCCAGCAACTACTACAACTAGACTGACCAACTGGCGGAGAG
CCTGCGCCCAAGATAGTTCCAATTGTGTACATACTGAACCGTATATTTTA
TAAACAATTTGTTGTGTTCCCGCATGCAAAGCAAAGTAGGATGTTCCAAA
GTAAAAATTAAAGTTAAAGCCAAAAAAAAAAAAAAAAAAA

IP06605.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG11110-RA 761 CG11110-RA 64..761 1..698 3490 100 Plus
CG33785-RA 1246 CG33785-RA 1145..1246 724..623 510 100 Minus
CG33786-RA 1245 CG33786-RA 1145..1245 724..624 505 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16528707..16529270 158..721 2820 100 Plus
chr2R 21145070 chr2R 16528485..16528643 1..159 795 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20641995..20642561 158..724 2835 100 Plus
2R 25286936 2R 20641773..20641931 1..159 795 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20643194..20643760 158..724 2835 100 Plus
2R 25260384 2R 20642972..20643130 1..159 795 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:09:06 has no hits.

IP06605.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:10:17 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16528485..16528642 1..158 100 -> Plus
chr2R 16528708..16529270 159..721 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:16 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 1..516 65..580 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:49 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 1..516 65..580 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:53:58 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 1..516 65..580 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:07:48 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 1..516 65..580 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:56 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 1..516 65..580 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:30 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 1..551 30..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:48 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 24..744 1..721 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:58 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 32..752 1..721 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:07:49 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 1..551 30..580 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:56 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
CG11110-RA 32..752 1..721 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:17 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20641773..20641930 1..158 100 -> Plus
2R 20641996..20642558 159..721 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:17 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20641773..20641930 1..158 100 -> Plus
2R 20641996..20642558 159..721 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:17 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20641773..20641930 1..158 100 -> Plus
2R 20641996..20642558 159..721 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:58 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16529278..16529435 1..158 100 -> Plus
arm_2R 16529501..16530063 159..721 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:40 Download gff for IP06605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20642972..20643129 1..158 100 -> Plus
2R 20643195..20643757 159..721 100   Plus

IP06605.hyp Sequence

Translation from 64 to 579

> IP06605.hyp
MAFRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVF
LLRWGTHNSQVERGDIISLISPKDPAQKIIKRVVGLQGDVVSTLGYKHEI
VRVPEGHCWVEGDHTGHSMDSNTFGPVALGLMSARAVAIVWPPERWRILE
NELPRRRRPIQASKNSSNYYN*

IP06605.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11110-PA 171 CG11110-PA 1..171 1..171 910 100 Plus
CG9240-PA 166 CG9240-PA 9..159 4..142 169 33.1 Plus
CG9240-PB 128 CG9240-PB 1..121 35..142 157 34.9 Plus

IP06605.pep Sequence

Translation from 64 to 579

> IP06605.pep
MAFRFFGKSLLYALPLGVTFLDCVGYVARVDGISMQPALNPVPDEKDYVF
LLRWGTHNSQVERGDIISLISPKDPAQKIIKRVVGLQGDVVSTLGYKHEI
VRVPEGHCWVEGDHTGHSMDSNTFGPVALGLMSARAVAIVWPPERWRILE
NELPRRRRPIQASKNSSNYYN*

IP06605.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12188-PA 171 GF12188-PA 1..171 1..171 860 91.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22048-PA 171 GG22048-PA 1..171 1..171 908 98.8 Plus
Dere\GG19383-PA 167 GG19383-PA 9..159 4..142 161 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21989-PA 169 GH21989-PA 1..169 1..171 808 87.1 Plus
Dgri\GH17636-PA 167 GH17636-PA 16..160 9..142 178 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11110-PA 171 CG11110-PA 1..171 1..171 910 100 Plus
CG9240-PA 166 CG9240-PA 9..159 4..142 169 33.1 Plus
CG9240-PB 128 CG9240-PB 1..121 35..142 157 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19690-PA 169 GI19690-PA 1..169 1..171 810 87.7 Plus
Dmoj\GI16074-PA 170 GI16074-PA 20..163 9..142 173 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17039-PA 169 GL17039-PA 1..169 1..171 776 83.6 Plus
Dper\GL16525-PA 160 GL16525-PA 15..152 9..142 162 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10765-PA 169 GA10765-PA 1..169 1..171 775 83.6 Plus
Dpse\GA21635-PA 160 GA21635-PA 15..152 9..142 159 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22032-PA 171 GM22032-PA 1..171 1..171 912 100 Plus
Dsec\GM22538-PA 166 GM22538-PA 14..159 9..142 165 32.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11530-PA 171 GD11530-PA 1..171 1..171 909 99.4 Plus
Dsim\GD15786-PA 166 GD15786-PA 9..159 4..142 169 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17277-PA 169 GJ17277-PA 1..169 1..171 799 86.5 Plus
Dvir\GJ15719-PA 170 GJ15719-PA 20..163 9..142 171 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21711-PA 169 GK21711-PA 1..169 1..171 806 88.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12129-PA 171 GE12129-PA 1..171 1..171 903 98.2 Plus
Dyak\GE16031-PA 166 GE16031-PA 9..159 4..142 170 32.5 Plus