Clone IP06608 Report

Search the DGRC for IP06608

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:66
Well:8
Vector:pOT2
Associated Gene/TranscriptCG11286-RB
Protein status:IP06608.pep: gold
Preliminary Size:623
Sequenced Size:819

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11286 2005-01-01 Successful iPCR screen
CG11286 2008-04-29 Release 5.5 accounting
CG11286 2008-08-15 Release 5.9 accounting
CG11286 2008-12-18 5.12 accounting

Clone Sequence Records

IP06608.complete Sequence

819 bp (819 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022573

> IP06608.complete
AGCAGTATCAAATTTTCAACATGTCCGCGACGAGCCTTGTAACCATTAAG
TCGATCCCCTCAGCGGGAGATGTCCTGCGGGGTAAAAATGTACCAGTTCA
CCGCCTCAACGCGAAGTTTGTGGCCAAGGCCCAGGAGAAGGCTAAGAAAG
TGGAGGAATTCCTGACTAGGACGAAGACCACTTCGTTGGTTTCCTTGTCA
GGACTTGCTTCCCGATATGAGTTCCATCGTCTCCAGGAGCTCGACGAGTG
GTATGAGCCAAGGATCAAGTTCCACGACGAGGCCGATGCCAGTTTGCATC
CCAGCTACGATATAAAGCACTTTCAGTAGTCAGTTAAGAAAGAACTTGCT
GAGTTACTTAGGTTTCCTGACACACCATTATTTCCAGCGATCTTAATTGC
TATGTGCGGTATCTGGACTCCAAAGCGAAATATGATAGGCAGTTCCTTCA
CGAAATGGAGCACATTATTGCCAATCAACGCAATATCTGCGACCAGTTTT
TCCTGAAGAAAATCCTGTGCTATAAAACAATGTGGCCCCCACTGCATACA
AAGAGGGAACTGAATAACTTTGTCTCAAAATTCTTTCAACTGCCTCCTAA
GGAAAAACGTCGCGTCGAGTATCTGTTGAAAACGGATTTAAGTCTGGGTT
GCTAAAACTGATCCAATTGCAAAGTAAATGAGCCTTTTTATTCCACTTGG
AAATGGTTTAATTAGCTCATTTAATTTTGCAATTATTCTCTGCAAAACTG
ATAAAATTACCTTATGGAAAATTGTACAGCCAATAAATTTAATTATGCAA
TTAAAAAAAAAAAAAAAAA

IP06608.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11286-RA 835 CG11286-RA 441..835 388..782 1975 100 Plus
CG11286-RA 835 CG11286-RA 113..440 1..328 1640 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3597271..3597780 510..1 2550 100 Minus
chr3R 27901430 chr3R 3596920..3597211 802..511 1460 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7771211..7771720 510..1 2550 100 Minus
3R 32079331 3R 7770857..7771151 805..511 1475 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7512042..7512551 510..1 2550 100 Minus
3R 31820162 3R 7511688..7511982 805..511 1475 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:41:02 has no hits.

IP06608.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:41:55 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3596920..3597211 511..802 100 <- Minus
chr3R 3597271..3597780 1..510 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:17 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 1..308 21..328 100 == Plus
CG11286-RA 309..576 388..655 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:04:41 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 1..308 21..328 100 == Plus
CG11286-RA 309..576 388..655 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:35 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RB 1..309 21..329 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:49:47 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 1..308 21..328 100 == Plus
CG11286-RA 309..576 388..655 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:16:42 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RB 1..309 21..329 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:51:45 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 28..355 1..328 100 == Plus
CG11286-RA 356..623 388..655 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:04:41 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 28..355 1..328 100 == Plus
CG11286-RA 356..623 388..655 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:35 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RB 37..838 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:49:47 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RA 28..355 1..328 100 == Plus
CG11286-RA 356..623 388..655 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:16:42 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
CG11286-RB 37..838 1..802 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:55 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7770860..7771151 511..802 100 <- Minus
3R 7771211..7771720 1..510 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:55 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7770860..7771151 511..802 100 <- Minus
3R 7771211..7771720 1..510 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:55 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7770860..7771151 511..802 100 <- Minus
3R 7771211..7771720 1..510 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:35 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3596582..3596873 511..802 100 <- Minus
arm_3R 3596933..3597442 1..510 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:24:28 Download gff for IP06608.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7511691..7511982 511..802 100 <- Minus
3R 7512042..7512551 1..510 100   Minus

IP06608.pep Sequence

Translation from 2 to 328

> IP06608.pep
QYQIFNMSATSLVTIKSIPSAGDVLRGKNVPVHRLNAKFVAKAQEKAKKV
EEFLTRTKTTSLVSLSGLASRYEFHRLQELDEWYEPRIKFHDEADASLHP
SYDIKHFQ*

IP06608.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17287-PA 161 GF17287-PA 37..120 22..108 164 43.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25006-PA 191 GG25006-PA 1..102 7..108 409 73.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG11286-PB 102 CG11286-PB 1..102 7..108 520 100 Plus
CG11286-PA 191 CG11286-PA 1..102 7..108 520 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10461-PA 191 GM10461-PA 1..102 7..108 424 86.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19465-PA 191 GD19465-PA 1..102 7..108 417 85.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25775-PA 191 GE25775-PA 1..102 7..108 434 78.4 Plus

IP06608.hyp Sequence

Translation from 2 to 328

> IP06608.hyp
QYQIFNMSATSLVTIKSIPSAGDVLRGKNVPVHRLNAKFVAKAQEKAKKV
EEFLTRTKTTSLVSLSGLASRYEFHRLQELDEWYEPRIKFHDEADASLHP
SYDIKHFQ*

IP06608.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11286-PB 102 CG11286-PB 1..102 7..108 520 100 Plus
CG11286-PA 191 CG11286-PA 1..102 7..108 520 100 Plus