Clone IP06614 Report

Search the DGRC for IP06614

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:66
Well:14
Vector:pOT2
Associated Gene/TranscriptMesh1-RA
Protein status:IP06614.pep: gold
Preliminary Size:540
Sequenced Size:662

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11900 2005-01-01 Successful iPCR screen
CG11900 2008-04-29 Release 5.5 accounting
CG11900 2008-08-15 Release 5.9 accounting
CG11900 2008-12-18 5.12 accounting

Clone Sequence Records

IP06614.complete Sequence

662 bp (662 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024375

> IP06614.complete
CAAAAAATAAGGTTTAGACTTTAAATTTGAACTAAAGGCCCGTTCATTTA
ATTATTTCTTACAACAATGGCCACATATCCATCTGCCAAATTCATGGAGT
GCCTCCAATATGCAGCTTTTAAGCACCGGCAGCAACGTCGCAAGGATCCT
CAGGAAACCCCCTATGTGAACCATGTGATCAATGTGAGCACTATTCTCTC
CGTGGAGGCCTGCATCACAGATGAGGGAGTCCTAATGGCTGCACTTCTGC
ACGATGTCGTGGAGGATACGGACGCATCTTTCGAGGATGTTGAGAAACTC
TTTGGACCGGATGTTTGTGGACTAGTGAGGGAGGTGACGGACGACAAGTC
CCTGGAGAAACAGGAGAGAAAACGCCTGCAAATAGAAAATGCAGCCAAAA
GCAGCTGCAGAGCAAAGCTCATAAAGCTGGCTGACAAATTGGATAACCTA
AGGGATCTGCAAGTCAACACACCGACAGGGTGGACACAGGAGCGTCGTGA
TCAGTACTTCGTTTGGGCCAAAAAGGTGGTGGACAATCTGCGAGGAACCA
ACGCCAACCTGGAGCTCAAGCTGGACGAGATCTTCCGCCAACGCGGCCTT
TTGTAAACGATCAAAAACCAACAAATTACAGATGAACCTGCTTAAAAAAA
AAAAAAAAAAAA

IP06614.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG11900-RA 682 CG11900-RA 24..663 1..640 3200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25024770..25025119 490..141 1735 99.7 Minus
chr3R 27901430 chr3R 25024559..25024712 640..487 740 98.7 Minus
chr3R 27901430 chr3R 25025182..25025326 145..1 725 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29201969..29202318 490..141 1750 100 Minus
3R 32079331 3R 29201758..29201911 640..487 770 100 Minus
3R 32079331 3R 29202381..29202525 145..1 725 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28942800..28943149 490..141 1750 100 Minus
3R 31820162 3R 28942589..28942742 640..487 770 100 Minus
3R 31820162 3R 28943212..28943356 145..1 725 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:44:25 has no hits.

IP06614.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:45:12 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25024557..25024709 490..643 98 <- Minus
chr3R 25024771..25025115 145..489 99 <- Minus
chr3R 25025183..25025326 1..144 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:19 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
CG11900-RA 1..540 67..606 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:31 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
CG11900-RA 1..540 67..606 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:38:18 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
Mesh1-RA 1..540 67..606 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:27 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
CG11900-RA 1..540 67..606 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:13 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
Mesh1-RA 1..540 67..606 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:41 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
CG11900-RA 1..642 1..643 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:31 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
CG11900-RA 1..642 1..643 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:38:18 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
Mesh1-RA 1..642 1..643 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:27 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
CG11900-RA 1..642 1..643 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:13 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
Mesh1-RA 1..642 1..643 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:12 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29201756..29201908 490..643 99 <- Minus
3R 29201970..29202314 145..489 100 <- Minus
3R 29202382..29202525 1..144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:12 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29201756..29201908 490..643 99 <- Minus
3R 29201970..29202314 145..489 100 <- Minus
3R 29202382..29202525 1..144 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:12 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29201756..29201908 490..643 99 <- Minus
3R 29201970..29202314 145..489 100 <- Minus
3R 29202382..29202525 1..144 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:38:18 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25027478..25027630 490..643 99 <- Minus
arm_3R 25027692..25028036 145..489 100 <- Minus
arm_3R 25028104..25028247 1..144 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:46 Download gff for IP06614.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28942587..28942739 490..643 99 <- Minus
3R 28942801..28943145 145..489 100 <- Minus
3R 28943213..28943356 1..144 100   Minus

IP06614.pep Sequence

Translation from 66 to 605

> IP06614.pep
MATYPSAKFMECLQYAAFKHRQQRRKDPQETPYVNHVINVSTILSVEACI
TDEGVLMAALLHDVVEDTDASFEDVEKLFGPDVCGLVREVTDDKSLEKQE
RKRLQIENAAKSSCRAKLIKLADKLDNLRDLQVNTPTGWTQERRDQYFVW
AKKVVDNLRGTNANLELKLDEIFRQRGLL*

IP06614.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18409-PA 179 GF18409-PA 1..179 1..179 873 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12030-PA 179 GG12030-PA 1..179 1..179 913 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14007-PA 175 GH14007-PA 3..175 6..179 664 75.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Mesh1-PA 179 CG11900-PA 1..179 1..179 923 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22351-PA 169 GI22351-PA 1..169 10..179 634 71.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13607-PA 179 GL13607-PA 1..179 1..179 800 84.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11268-PA 179 GA11268-PA 1..179 1..179 806 84.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12255-PA 179 GM12255-PA 1..179 1..179 927 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17928-PA 179 GD17928-PA 1..179 1..179 949 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14232-PA 175 GJ14232-PA 3..175 6..179 669 72.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22495-PA 178 GK22495-PA 3..178 4..179 759 80.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10467-PA 179 GE10467-PA 1..179 1..179 910 95 Plus

IP06614.hyp Sequence

Translation from 66 to 605

> IP06614.hyp
MATYPSAKFMECLQYAAFKHRQQRRKDPQETPYVNHVINVSTILSVEACI
TDEGVLMAALLHDVVEDTDASFEDVEKLFGPDVCGLVREVTDDKSLEKQE
RKRLQIENAAKSSCRAKLIKLADKLDNLRDLQVNTPTGWTQERRDQYFVW
AKKVVDNLRGTNANLELKLDEIFRQRGLL*

IP06614.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Mesh1-PA 179 CG11900-PA 1..179 1..179 923 100 Plus