BDGP Sequence Production Resources |
Search the DGRC for IP06639
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 66 |
Well: | 39 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13086 |
Protein status: | IP06639.pep: Imported from assembly |
Preliminary Size: | 549 |
Sequenced Size: | 747 |
Gene | Date | Evidence |
---|---|---|
CG13086 | 2005-01-01 | Successful iPCR screen |
CG13086 | 2008-04-29 | Stopped prior to 5.5 |
747 bp assembled on 2011-03-17
> IP06639.complete CCGAATCGCGCGACGCGGAAGAAATATCGCCGGATTCGACTCCACATTTT CCTGGCATTATCCCTATGGTTCCTGATCGAGGCTCATCCCGTCGAAGGAA CACGGTGCAGGAATCCCTATGAGAGGGTACGGGAAAACTATTGCTACTTC GTTGCTGACGAGGAACCGCTGCACACATCGTTCCATAACTTTTGCTATCA GGACAAGCGCACCTCACGAGTTTGCCTGGATAGTGACGAGGAAATGCGCG TTCTGGCCCATCACCTGGCCAACTTGGGCTACCCGAACGGCACGCAGTTC TGGAGCGCCGGGCATCGATGGCCGGGTGATAACCGCTTCTACTGGAACTA CTTTGGCAGAGCCCGACCGCTCAACTACTCCAACTGGGCGGTGGACGAGC CGACGCCCCAAATGGGCCGCAATTGCCTGATCCTCACTCTCCAGGGTGGA GAACTCATCATGAGCAGTGAGTCCTGCTACACCCGAGCGGTCGATATCTG CGAACAGACGCTGAACGGCACGGATTCCCGTCCCGTAATCCACTGATCGC CAGATATTTATGTATCTCAATATCTACTAAAGTACCTAGCAAAAGAAACC CAAATAAAAAAAAAGACAACACCTTCTAGCAGAATTACAATAATAATTAA GAACTTCACTTTGAACACTTTGAAACAAACACACGCGAATCGATATAGTT AAACAAAGGAAGCCTATTCCCAGTCCAACAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 19363512..19363939 | 171..598 | 2095 | 99.3 | Plus |
chr2L | 23010047 | chr2L | 19362938..19363108 | 1..171 | 840 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 5740434..5740575 | 588..729 | 695 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19364973..19365400 | 171..598 | 2125 | 99.8 | Plus |
2L | 23513712 | 2L | 19364397..19364567 | 1..171 | 855 | 100 | Plus |
3L | 28110227 | 3L | 5747898..5748052 | 588..742 | 760 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19364973..19365409 | 171..606 | 2130 | 99.5 | Plus |
2L | 23513712 | 2L | 19364397..19364567 | 1..171 | 855 | 100 | Plus |
3L | 28103327 | 3L | 5740998..5741152 | 588..742 | 760 | 99.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19362938..19363108 | 1..171 | 99 | -> | Plus |
chr2L | 19363513..19363945 | 172..601 | 98 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 4..549 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 4..549 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 4..549 | 1..546 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RA | 4..598 | 1..595 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RB | 23..629 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13086-RB | 23..629 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364397..19364567 | 1..171 | 100 | -> | Plus |
2L | 19364974..19365406 | 172..601 | 99 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364397..19364567 | 1..171 | 100 | -> | Plus |
2L | 19364974..19365406 | 172..601 | 99 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364397..19364567 | 1..171 | 100 | -> | Plus |
2L | 19364974..19365406 | 172..601 | 99 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19364397..19364567 | 1..171 | 100 | -> | Plus |
arm_2L | 19364974..19365406 | 172..601 | 99 | <- | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19364974..19365406 | 172..601 | 99 | <- | Plus |
2L | 19364397..19364567 | 1..171 | 100 | -> | Plus |
Translation from 0 to 545
> IP06639.pep PNRATRKKYRRIRLHIFLALSLWFLIEAHPVEGTRCRNPYERVRENYCYF VADEEPLHTSFHNFCYQDKRTSRVCLDSDEEMRVLAHHLANLGYPNGTQF WSAGHRWPGDNRFYWNYFGRARPLNYSNWAVDEPTPQMGRNCLILTLQGG ELIMSSESCYTRAVDICEQTLNGTDSRPVIH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14713-PA | 372 | GF14713-PA | 3..182 | 2..181 | 739 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21170-PA | 182 | GG21170-PA | 2..182 | 1..181 | 905 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13444-PA | 174 | GH13444-PA | 28..174 | 33..181 | 570 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13086-PB | 182 | CG13086-PB | 2..182 | 1..181 | 1014 | 100 | Plus |
CG13086-PA | 182 | CG13086-PA | 2..182 | 1..181 | 1014 | 100 | Plus |
CG13086-PC | 167 | CG13086-PC | 2..167 | 1..181 | 904 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14006-PA | 176 | GI14006-PA | 15..169 | 18..172 | 604 | 69.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21199-PA | 182 | GL21199-PA | 17..182 | 17..181 | 689 | 75.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12036-PA | 349 | GA12036-PA | 7..172 | 4..172 | 683 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17337-PA | 182 | GM17337-PA | 2..182 | 1..181 | 967 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24195-PA | 182 | GD24195-PA | 2..182 | 1..181 | 964 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18250-PA | 173 | GJ18250-PA | 25..173 | 31..181 | 579 | 67.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23828-PA | 178 | GK23828-PA | 2..178 | 1..181 | 658 | 68.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13243-PA | 182 | GE13243-PA | 2..182 | 1..181 | 921 | 92.8 | Plus |
Translation from 0 to 545
> IP06639.hyp PNRATRKKYRRIRLHIFLALSLWFLIEAHPVEGTRCRNPYERVRENYCYF VADEEPLHTSFHNFCYQDKRTSRVCLDSDEEMRVLAHHLANLGYPNGTQF WSAGHRWPGDNRFYWNYFGRARPLNYSNWAVDEPTPQMGRNCLILTLQGG ELIMSSESCYTRAVDICEQTLNGTDSRPVIH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13086-PB | 182 | CG13086-PB | 2..182 | 1..181 | 1014 | 100 | Plus |
CG13086-PA | 182 | CG13086-PA | 2..182 | 1..181 | 1014 | 100 | Plus |
CG13086-PC | 167 | CG13086-PC | 2..167 | 1..181 | 904 | 91.7 | Plus |