Clone IP06639 Report

Search the DGRC for IP06639

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:66
Well:39
Vector:pOT2
Associated Gene/TranscriptCG13086
Protein status:IP06639.pep: Imported from assembly
Preliminary Size:549
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13086 2005-01-01 Successful iPCR screen
CG13086 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

IP06639.complete Sequence

747 bp assembled on 2011-03-17

> IP06639.complete
CCGAATCGCGCGACGCGGAAGAAATATCGCCGGATTCGACTCCACATTTT
CCTGGCATTATCCCTATGGTTCCTGATCGAGGCTCATCCCGTCGAAGGAA
CACGGTGCAGGAATCCCTATGAGAGGGTACGGGAAAACTATTGCTACTTC
GTTGCTGACGAGGAACCGCTGCACACATCGTTCCATAACTTTTGCTATCA
GGACAAGCGCACCTCACGAGTTTGCCTGGATAGTGACGAGGAAATGCGCG
TTCTGGCCCATCACCTGGCCAACTTGGGCTACCCGAACGGCACGCAGTTC
TGGAGCGCCGGGCATCGATGGCCGGGTGATAACCGCTTCTACTGGAACTA
CTTTGGCAGAGCCCGACCGCTCAACTACTCCAACTGGGCGGTGGACGAGC
CGACGCCCCAAATGGGCCGCAATTGCCTGATCCTCACTCTCCAGGGTGGA
GAACTCATCATGAGCAGTGAGTCCTGCTACACCCGAGCGGTCGATATCTG
CGAACAGACGCTGAACGGCACGGATTCCCGTCCCGTAATCCACTGATCGC
CAGATATTTATGTATCTCAATATCTACTAAAGTACCTAGCAAAAGAAACC
CAAATAAAAAAAAAGACAACACCTTCTAGCAGAATTACAATAATAATTAA
GAACTTCACTTTGAACACTTTGAAACAAACACACGCGAATCGATATAGTT
AAACAAAGGAAGCCTATTCCCAGTCCAACAAAAAAAAAAAAAAAAAA

IP06639.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19363512..19363939 171..598 2095 99.3 Plus
chr2L 23010047 chr2L 19362938..19363108 1..171 840 99.4 Plus
chr3L 24539361 chr3L 5740434..5740575 588..729 695 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19364973..19365400 171..598 2125 99.8 Plus
2L 23513712 2L 19364397..19364567 1..171 855 100 Plus
3L 28110227 3L 5747898..5748052 588..742 760 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19364973..19365409 171..606 2130 99.5 Plus
2L 23513712 2L 19364397..19364567 1..171 855 100 Plus
3L 28103327 3L 5740998..5741152 588..742 760 99.3 Plus
Blast to na_te.dros performed on 2019-03-16 22:32:38 has no hits.

IP06639.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:33:41 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19362938..19363108 1..171 99 -> Plus
chr2L 19363513..19363945 172..601 98 <- Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:14 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
CG13086-RA 4..549 1..546 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:57:27 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
CG13086-RA 4..549 1..546 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:29:41 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
CG13086-RA 4..549 1..546 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:14 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
CG13086-RA 4..598 1..595 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:57:27 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
CG13086-RB 23..629 1..606 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:41 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
CG13086-RB 23..629 1..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:41 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19364397..19364567 1..171 100 -> Plus
2L 19364974..19365406 172..601 99 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:41 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19364397..19364567 1..171 100 -> Plus
2L 19364974..19365406 172..601 99 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:41 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19364397..19364567 1..171 100 -> Plus
2L 19364974..19365406 172..601 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:57:27 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19364397..19364567 1..171 100 -> Plus
arm_2L 19364974..19365406 172..601 99 <- Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:02:03 Download gff for IP06639.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19364974..19365406 172..601 99 <- Plus
2L 19364397..19364567 1..171 100 -> Plus

IP06639.pep Sequence

Translation from 0 to 545

> IP06639.pep
PNRATRKKYRRIRLHIFLALSLWFLIEAHPVEGTRCRNPYERVRENYCYF
VADEEPLHTSFHNFCYQDKRTSRVCLDSDEEMRVLAHHLANLGYPNGTQF
WSAGHRWPGDNRFYWNYFGRARPLNYSNWAVDEPTPQMGRNCLILTLQGG
ELIMSSESCYTRAVDICEQTLNGTDSRPVIH*

IP06639.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14713-PA 372 GF14713-PA 3..182 2..181 739 75 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21170-PA 182 GG21170-PA 2..182 1..181 905 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13444-PA 174 GH13444-PA 28..174 33..181 570 68.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13086-PB 182 CG13086-PB 2..182 1..181 1014 100 Plus
CG13086-PA 182 CG13086-PA 2..182 1..181 1014 100 Plus
CG13086-PC 167 CG13086-PC 2..167 1..181 904 91.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14006-PA 176 GI14006-PA 15..169 18..172 604 69.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21199-PA 182 GL21199-PA 17..182 17..181 689 75.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12036-PA 349 GA12036-PA 7..172 4..172 683 74 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17337-PA 182 GM17337-PA 2..182 1..181 967 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24195-PA 182 GD24195-PA 2..182 1..181 964 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18250-PA 173 GJ18250-PA 25..173 31..181 579 67.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23828-PA 178 GK23828-PA 2..178 1..181 658 68.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13243-PA 182 GE13243-PA 2..182 1..181 921 92.8 Plus

IP06639.hyp Sequence

Translation from 0 to 545

> IP06639.hyp
PNRATRKKYRRIRLHIFLALSLWFLIEAHPVEGTRCRNPYERVRENYCYF
VADEEPLHTSFHNFCYQDKRTSRVCLDSDEEMRVLAHHLANLGYPNGTQF
WSAGHRWPGDNRFYWNYFGRARPLNYSNWAVDEPTPQMGRNCLILTLQGG
ELIMSSESCYTRAVDICEQTLNGTDSRPVIH*

IP06639.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13086-PB 182 CG13086-PB 2..182 1..181 1014 100 Plus
CG13086-PA 182 CG13086-PA 2..182 1..181 1014 100 Plus
CG13086-PC 167 CG13086-PC 2..167 1..181 904 91.7 Plus