Clone IP06655 Report

Search the DGRC for IP06655

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:66
Well:55
Vector:pOT2
Associated Gene/TranscriptCG13538-RA
Protein status:IP06655.pep: gold
Preliminary Size:519
Sequenced Size:927

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13538 2005-01-01 Successful iPCR screen
CG13538 2008-04-29 Release 5.5 accounting
CG13538 2008-08-15 Release 5.9 accounting
CG13538 2008-12-18 5.12 accounting

Clone Sequence Records

IP06655.complete Sequence

927 bp (927 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022574

> IP06655.complete
AGACATGATGTTGGCCGATGAATTTGAAACGATGTGCAAGAATTATTTTG
TAAATTCCATGACTCACGTCTGCTCGTCCCTCGTCCCGGAATCGCTGACC
AAGAAGTATCGCAATCGGCTGATCATTCCCAAGGATCCCTACAGTATCTT
CAAGCTGAACAGCCGGAATTCCAGCTATCTCCTCGCCTTCCGCTTCCCGG
AAATGCGCAATTGCCGAAAACTCTGGATGTCGGATTTGCGCAATCTAAAT
TGCGAGATTAAAGGCGGCAAAATGAAGAACTTCTTCTTCGCCAATAGCTA
CCGCAAGTGCTACAACTTTGCCATGGACCTAACCTCGGAGCTAAAGGCGC
ACTGCGGCGCCAAGAACAATGAGGAGGATACGCAGTCGGGCTACTACTAC
ACGAACTTCGACGGGAATCCGGTCATTCAGACCAACTCAACTGCTTGTCT
TTTGCTGGGAACTTCAACTCTGGTACTCTGCCTGATCATCTCGTTTCTAA
TGTTCGCCATTCTGCAATGGAAGGCATCTCGGCTGCGAGGCAGCAAGTCA
GTCCAAGGCGGTCCATGTGAATCCTAGTCAATCTCTTTTGAAAATCTTCT
GACATGAGGAGTTAGTATTCCTGGGATATGAATGCCTTTAAGGCCTTGTG
GATGAGATTTCAAAGTTCCGATTACCACAGTCTTTATCAAGGATGTGCAG
ATATCAATATTCTTAAACTATACATTTGGCAAAAGGAATTGTCTTCCAAA
TCGAACATGTCGTTCTGACACGCTTCGCTTGAGTTGTAATTTGAAATTTT
GCGAGATCTAGAAACAATTTCTATGTCATCTGGAGAAATCGCTTCCAAAT
CATCGGAAAATTTCCAATGACAGCTGAAATAAAAATTATATGTCTGTAAT
TACTAAAAAAAAAAAAAAAAAAAAAAA

IP06655.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13538-RA 904 CG13538-RA 1..904 1..904 4520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18973718..18974611 1..904 4200 97.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23087262..23088168 1..907 4535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23088461..23089367 1..907 4535 100 Plus
Blast to na_te.dros performed 2019-03-16 02:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 44..88 23..67 117 73.3 Plus

IP06655.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:48:50 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18973718..18974611 1..904 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:22 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:37:47 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:48 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:14:11 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..573 5..577 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:20 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..573 5..577 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:41:55 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..904 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:37:47 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..904 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:48 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 86..989 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:14:12 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 1..904 1..904 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:20 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
CG13538-RA 86..989 1..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:50 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23087262..23088165 1..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:50 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23087262..23088165 1..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:50 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23087262..23088165 1..904 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:48 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18974785..18975688 1..904 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:28 Download gff for IP06655.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23088479..23089382 1..904 100   Plus

IP06655.hyp Sequence

Translation from 0 to 576

> IP06655.hyp
DMMLADEFETMCKNYFVNSMTHVCSSLVPESLTKKYRNRLIIPKDPYSIF
KLNSRNSSYLLAFRFPEMRNCRKLWMSDLRNLNCEIKGGKMKNFFFANSY
RKCYNFAMDLTSELKAHCGAKNNEEDTQSGYYYTNFDGNPVIQTNSTACL
LLGTSTLVLCLIISFLMFAILQWKASRLRGSKSVQGGPCES*

IP06655.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13538-PA 190 CG13538-PA 1..190 2..191 1014 100 Plus

IP06655.pep Sequence

Translation from 4 to 576

> IP06655.pep
MMLADEFETMCKNYFVNSMTHVCSSLVPESLTKKYRNRLIIPKDPYSIFK
LNSRNSSYLLAFRFPEMRNCRKLWMSDLRNLNCEIKGGKMKNFFFANSYR
KCYNFAMDLTSELKAHCGAKNNEEDTQSGYYYTNFDGNPVIQTNSTACLL
LGTSTLVLCLIISFLMFAILQWKASRLRGSKSVQGGPCES*

IP06655.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11559-PA 196 GF11559-PA 1..179 2..180 372 39.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22829-PA 159 GG22829-PA 1..159 19..177 477 62.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13538-PA 190 CG13538-PA 1..190 1..190 1014 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24751-PA 185 GA24751-PA 18..185 5..173 161 22.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15987-PA 176 GM15987-PA 1..176 1..177 726 76.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15451-PA 101 GD15451-PA 2..101 77..177 405 77.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24868-PA 179 GK24868-PA 3..178 2..178 137 25.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14263-PA 177 GE14263-PA 1..177 1..177 670 68.9 Plus