Clone IP06685 Report

Search the DGRC for IP06685

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:66
Well:85
Vector:pOT2
Associated Gene/TranscriptCG14362-RA
Protein status:IP06685.pep: gold
Preliminary Size:621
Sequenced Size:709

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14362 2005-01-01 Successful iPCR screen
CG14362 2008-04-29 Release 5.5 accounting
CG14362 2008-08-15 Release 5.9 accounting
CG14362 2008-12-18 5.12 accounting

Clone Sequence Records

IP06685.complete Sequence

709 bp (709 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023601

> IP06685.complete
ACAGAATGGGATGTCTGTGTTTGAGGAAGTTCTCCTCGTATCCCTCAGTT
CCACAAGAGATTATGAACACCCTCAGGATGAATACAGCACTAAGTCGTAG
TCAGATCAAGTATCTGTATATTCGATTCCACCAGTTTTCAGGAGGAGGCA
AAGATCCCCCAAGTCATCTGCACAAGTACAATTTCTATTCAGGACTACTG
CAACTAAACCCCTTGCTGCCCACCATATTGAACTCCATGTTCGGGAATAA
AGTGACAATTACCTTTGTGGATTTCGCTCTGTTTCTGAGCACCTTTCAGG
CCCATTCTCTTAAAACCTCCAATGAGCTAAAAAATGTGATGATGGACAAG
AAATTAAGGTTAATTTTCAACATGTACGATAACAACAAGGACGGTCGTAT
TACAAAGTATGACTTGGTTGTAGTTGTCCACAAGCTGTTCTCAAATCTAT
TGGATCACGTGCAGATAATGCGCATTGTGAATACCATAATGAAGGAAATG
GATCATACGGACTCGAACCAAATAATGTTCCAAGACTTCTGCAAAGCATT
CGCAGTCTTCGACATGACCGAAATGATGGTCACCTGGATACCCGAATACC
ATGGTCGAACCACAGATGATTTGTAATAAGTAATTCGTTTATTTATTCAA
CTGCACAAAAATTTGAAAATTAAATGTACACATGATTTAAAAAAAAAAAA
AAAAAAAAA

IP06685.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14362.a 1169 CG14362.a 147..835 1..689 3445 100 Plus
CG14362-RA 1169 CG14362-RA 147..835 1..689 3445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9679472..9679799 688..361 1580 98.8 Minus
chr3R 27901430 chr3R 9679914..9680183 360..91 1335 99.6 Minus
chr3R 27901430 chr3R 9680240..9680329 90..1 450 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13854598..13854926 689..361 1645 100 Minus
3R 32079331 3R 13855039..13855308 360..91 1350 100 Minus
3R 32079331 3R 13855365..13855454 90..1 450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13595429..13595757 689..361 1645 100 Minus
3R 31820162 3R 13595870..13596139 360..91 1350 100 Minus
3R 31820162 3R 13596196..13596285 90..1 450 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:59:19 has no hits.

IP06685.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:00:37 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9680240..9680329 1..90 100   Minus
chr3R 9679472..9679799 361..688 98 <- Minus
chr3R 9679914..9680183 91..360 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:24 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..621 6..626 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:44 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..621 6..626 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:10:07 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..621 6..626 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:09 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..621 6..626 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:53:29 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..621 6..626 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:06 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..621 6..626 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:43 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..688 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:10:07 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..688 1..688 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:09 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..621 6..626 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:53:29 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
CG14362-RA 1..688 1..688 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:00:37 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13854599..13854926 361..688 100 <- Minus
3R 13855039..13855308 91..360 100 <- Minus
3R 13855365..13855454 1..90 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:00:37 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13854599..13854926 361..688 100 <- Minus
3R 13855039..13855308 91..360 100 <- Minus
3R 13855365..13855454 1..90 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:00:37 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13854599..13854926 361..688 100 <- Minus
3R 13855039..13855308 91..360 100 <- Minus
3R 13855365..13855454 1..90 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:10:07 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9680321..9680648 361..688 100 <- Minus
arm_3R 9680761..9681030 91..360 100 <- Minus
arm_3R 9681087..9681176 1..90 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:43 Download gff for IP06685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13595430..13595757 361..688 100 <- Minus
3R 13595870..13596139 91..360 100 <- Minus
3R 13596196..13596285 1..90 100   Minus

IP06685.hyp Sequence

Translation from 2 to 625

> IP06685.hyp
RMGCLCLRKFSSYPSVPQEIMNTLRMNTALSRSQIKYLYIRFHQFSGGGK
DPPSHLHKYNFYSGLLQLNPLLPTILNSMFGNKVTITFVDFALFLSTFQA
HSLKTSNELKNVMMDKKLRLIFNMYDNNKDGRITKYDLVVVVHKLFSNLL
DHVQIMRIVNTIMKEMDHTDSNQIMFQDFCKAFAVFDMTEMMVTWIPEYH
GRTTDDL*

IP06685.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14362-PA 206 CG14362-PA 1..206 2..207 1086 100 Plus
elm-PB 189 CG2185-PB 17..183 24..192 147 26.9 Plus
elm-PA 189 CG2185-PA 17..183 24..192 147 26.9 Plus

IP06685.pep Sequence

Translation from 5 to 625

> IP06685.pep
MGCLCLRKFSSYPSVPQEIMNTLRMNTALSRSQIKYLYIRFHQFSGGGKD
PPSHLHKYNFYSGLLQLNPLLPTILNSMFGNKVTITFVDFALFLSTFQAH
SLKTSNELKNVMMDKKLRLIFNMYDNNKDGRITKYDLVVVVHKLFSNLLD
HVQIMRIVNTIMKEMDHTDSNQIMFQDFCKAFAVFDMTEMMVTWIPEYHG
RTTDDL*

IP06685.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18903-PA 216 GF18903-PA 1..206 1..205 858 76.2 Plus
Dana\GF17404-PA 189 GF17404-PA 12..183 18..191 147 26.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17018-PA 207 GG17018-PA 1..206 1..206 999 87.9 Plus
Dere\GG10903-PA 189 GG10903-PA 12..183 18..191 147 26.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19192-PA 189 GH19192-PA 12..183 18..191 139 27.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14362-PA 206 CG14362-PA 1..206 1..206 1086 100 Plus
elm-PB 189 CG2185-PB 17..183 23..191 147 26.9 Plus
elm-PA 189 CG2185-PA 17..183 23..191 147 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24225-PA 189 GI24225-PA 12..183 18..191 143 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23327-PA 214 GL23327-PA 3..204 2..205 697 64.2 Plus
Dper\GL23144-PA 189 GL23144-PA 12..188 18..195 138 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12933-PA 214 GA12933-PA 3..204 2..205 698 64.2 Plus
Dpse\GA27156-PA 189 GA27156-PA 12..188 18..195 138 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25902-PA 207 GM25902-PA 1..206 1..206 1066 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20471-PA 207 GD20471-PA 1..206 1..206 1068 95.6 Plus
Dsim\GD19593-PA 189 GD19593-PA 12..183 18..191 149 26.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10797-PA 189 GJ10797-PA 12..183 18..191 151 27.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10850-PA 189 GK10850-PA 12..183 18..191 141 26 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24409-PA 207 GE24409-PA 1..206 1..206 980 86.4 Plus
Dyak\GE24150-PA 189 GE24150-PA 12..183 18..191 147 26.6 Plus