Clone IP06701 Report

Search the DGRC for IP06701

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:67
Well:1
Vector:pOT2
Associated Gene/TranscriptCG10140-RB
Protein status:IP06701.pep: wuzgold
Preliminary Size:543
Sequenced Size:925

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10140 2005-01-01 Successful iPCR screen
CG10140 2008-04-29 Release 5.5 accounting
CG10140 2008-08-15 Release 5.9 accounting
CG10140 2008-12-18 5.12 accounting

Clone Sequence Records

IP06701.complete Sequence

925 bp (925 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022577

> IP06701.complete
TGGAGGTGTGCGGTTCAGAAGTTGGAATACAAAACTATTATAATTTTTCT
GTTTTGCAGAAGTAATATGGTACTTTATCTGCATATTTTGCGGTGTTTTT
GGAGCAAGACCCAAAGACTTGGACGTTTCTGGAACAACAGATAGCACCCT
AGAAACGGATTCAACTACTTCCGGTCTGGAATATGGTCTAATTACGGGCA
ACTTGAGTATCTGCGGAAATGTGGCAGATAATGTGTTTCTACCATTTGTG
GGGGACTGTAATAGGTACTACCTTTGTCGCTCTGGACAAGCCATAGAACT
GCAATGCGAATGGCCTTATGAGTTCAATGCAAATACCCAAAGCTGTGTAC
ATCCTGGTGACGCTGATTGTCTGCCCACCTGCGAGGCTTTCAATTTCAGC
ACCTTCAGTTACCAGAGAACCTGTACGAGATCGCTGTGATTTCCCCCAAA
ATGTCGATTGCGTGGAGTCCGAGTGCTCCATCTACTCCAATGCGTATCAT
TTGCGCTATGTTCCCAGCAAGGTTTCCTGCCAGAAGTACTTCATCTGCGG
CAACGGAATTCCCAGGGAGCAAACCTGCACTGCTGGCCTCCACTTTAGTA
CCAAATGCGATTGCTGCGATATTCCATCTAAGTCGGACTGTCAGATCCCA
GCAGTGGAAAGAAAAGTGCAGCAACTTTCACGACTTTCACCCGTTACTAC
TGTAGGAATCTGCCCCCCATCCGGGGTCCATTTCTATGTCCATGAGTCTC
GACGAGATGCCTATTACTATTGCGTGGATGGACATGGTCTGGTTCTGGAT
TGTTCGGCGGGTCTTTGGTACGACCCCACGGTTCAGGAGTGTCGTGAACC
CCAGAATGTGGGCATGTAACATGGTTGATCTGAATAAAAATTGTTTTTGT
GACAAAAGTAAAAAAAAAAAAAAAA

IP06701.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG10140-RB 909 CG10140-RB 1..909 1..909 4545 100 Plus
CG10140-RA 1024 CG10140-RA 488..970 428..910 2415 100 Plus
CG10140.a 1220 CG10140.a 684..1166 428..910 2415 100 Plus
CG10140-RA 1024 CG10140-RA 44..415 58..429 1860 100 Plus
CG10140.a 1220 CG10140.a 240..611 58..429 1860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13430375..13430655 281..1 1375 99.3 Minus
chr3L 24539361 chr3L 13429548..13429814 909..643 1275 98.5 Minus
chr3L 24539361 chr3L 13429875..13430091 644..428 1070 99.5 Minus
chr3L 24539361 chr3L 13430164..13430311 429..282 710 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13440150..13440430 281..1 1405 100 Minus
3L 28110227 3L 13439316..13439583 910..643 1340 100 Minus
3L 28110227 3L 13439644..13439860 644..428 1085 100 Minus
3L 28110227 3L 13439933..13440080 429..282 740 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13433250..13433530 281..1 1405 100 Minus
3L 28103327 3L 13432416..13432683 910..643 1340 100 Minus
3L 28103327 3L 13432744..13432960 644..428 1085 100 Minus
3L 28103327 3L 13433033..13433180 429..282 740 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:15:28 has no hits.

IP06701.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:16:26 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13429548..13429812 645..909 98 <- Minus
chr3L 13429875..13430089 430..644 99 <- Minus
chr3L 13430164..13430311 282..429 98 <- Minus
chr3L 13430375..13430655 1..281 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:25 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RA 2..380 50..429 98 -> Plus
CG10140-RA 455..894 430..869 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:06 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RB 1..552 318..869 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:51:08 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RB 1..552 318..869 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:56 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RA 2..380 50..429 98 -> Plus
CG10140-RA 455..894 430..869 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:38:05 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RA 2..380 50..429 98 -> Plus
CG10140-RA 455..894 430..869 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:21 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RA 2..380 50..429 98 -> Plus
CG10140-RA 455..894 430..869 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:06 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RB 1..909 1..909 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:51:08 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RB 1..909 1..909 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:56 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RA 2..380 50..429 98 -> Plus
CG10140-RA 455..894 430..869 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:38:05 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
CG10140-RA 37..415 50..429 98 -> Plus
CG10140-RA 490..969 430..909 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:26 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13439317..13439581 645..909 100 <- Minus
3L 13439644..13439858 430..644 100 <- Minus
3L 13439933..13440080 282..429 100 <- Minus
3L 13440150..13440430 1..281 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:26 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13439317..13439581 645..909 100 <- Minus
3L 13439644..13439858 430..644 100 <- Minus
3L 13439933..13440080 282..429 100 <- Minus
3L 13440150..13440430 1..281 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:26 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13439317..13439581 645..909 100 <- Minus
3L 13439644..13439858 430..644 100 <- Minus
3L 13439933..13440080 282..429 100 <- Minus
3L 13440150..13440430 1..281 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:51:08 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13432417..13432681 645..909 100 <- Minus
arm_3L 13433250..13433530 1..281 100   Minus
arm_3L 13432744..13432958 430..644 100 <- Minus
arm_3L 13433033..13433180 282..429 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:00 Download gff for IP06701.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13433033..13433180 282..429 100 <- Minus
3L 13432744..13432958 430..644 100 <- Minus
3L 13432417..13432681 645..909 100 <- Minus
3L 13433250..13433530 1..281 100   Minus

IP06701.hyp Sequence

Translation from 317 to 868

> IP06701.hyp
MSSMQIPKAVYILVTLIVCPPARLSISAPSVTREPVRDRCDFPQNVDCVE
SECSIYSNAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCDCC
DIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYY
YCVDGHGLVLDCSAGLWYDPTVQECREPQNVGM*

IP06701.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG10140-PA 297 CG10140-PA 152..297 38..183 827 100 Plus
CG10154-PB 316 CG10154-PB 171..316 38..183 414 49.7 Plus
CG10154-PA 316 CG10154-PA 171..316 38..183 414 49.7 Plus
CG10725-PB 269 CG10725-PB 124..268 38..182 393 44.8 Plus
CG33986-PB 277 CG33986-PB 141..259 64..176 168 31.1 Plus
CG10725-PB 269 CG10725-PB 96..192 70..181 159 31.2 Plus

IP06701.pep Sequence

Translation from 317 to 868

> IP06701.pep
MSSMQIPKAVYILVTLIVCPPARLSISAPSVTREPVRDRCDFPQNVDCVE
SECSIYSNAYHLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCDCC
DIPSKSDCQIPAVERKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYY
YCVDGHGLVLDCSAGLWYDPTVQECREPQNVGM*

IP06701.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10951-PA 316 GF10951-PA 170..313 34..182 576 70.5 Plus
Dana\GF10952-PA 308 GF10952-PA 163..308 38..183 410 52.4 Plus
Dana\GF23484-PA 275 GF23484-PA 135..275 38..178 365 45.4 Plus
Dana\GF24468-PA 266 GF24468-PA 86..248 23..176 168 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13766-PA 296 GG13766-PA 149..296 36..183 709 86.5 Plus
Dere\GG15643-PA 270 GG15643-PA 123..270 36..183 372 45.3 Plus
Dere\GG13767-PA 301 GG13767-PA 156..301 38..183 371 49.7 Plus
Dere\GG13542-PA 290 GG13542-PA 154..272 64..176 150 31.9 Plus
Dere\GG15643-PA 270 GG15643-PA 97..194 70..182 140 29.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14674-PA 299 GH14674-PA 156..296 38..178 458 55.3 Plus
Dgri\GH14675-PA 331 GH14675-PA 185..329 38..182 417 52.4 Plus
Dgri\GH16897-PA 268 GH16897-PA 123..266 38..181 398 45.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10140-PA 297 CG10140-PA 152..297 38..183 827 100 Plus
CG10154-PB 316 CG10154-PB 171..316 38..183 414 49.7 Plus
CG10154-PA 316 CG10154-PA 171..316 38..183 414 49.7 Plus
CG10725-PB 269 CG10725-PB 124..268 38..182 393 44.8 Plus
CG33986-PB 277 CG33986-PB 141..259 64..176 168 31.1 Plus
CG10725-PB 269 CG10725-PB 96..192 70..181 159 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13784-PA 302 GI13784-PA 156..301 38..183 485 56.8 Plus
Dmoj\GI13785-PA 334 GI13785-PA 189..334 38..183 409 50.7 Plus
Dmoj\GI11514-PA 274 GI11514-PA 129..272 38..181 389 47.2 Plus
Dmoj\GI12221-PA 269 GI12221-PA 143..253 64..176 150 31 Plus
Dmoj\GI17587-PA 316 GI17587-PA 30..188 20..183 141 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25430-PA 292 GL25430-PA 147..292 38..183 600 74 Plus
Dper\GL25431-PA 299 GL25431-PA 152..298 36..182 411 54.1 Plus
Dper\GL25445-PA 268 GL25445-PA 123..264 38..179 354 43 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28613-PA 292 GA28613-PA 147..292 38..183 600 74 Plus
Dpse\GA28614-PA 299 GA28614-PA 152..298 36..182 410 54.1 Plus
Dpse\GA10525-PA 268 GA10525-PA 123..264 38..179 354 43 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24590-PA 293 GM24590-PA 148..293 38..183 756 95.2 Plus
Dsec\GM24591-PA 301 GM24591-PA 156..301 38..183 390 49.7 Plus
Dsec\GM25419-PA 271 GM25419-PA 124..271 36..183 373 44.6 Plus
Dsec\GM24485-PA 274 GM24485-PA 141..256 64..176 150 31 Plus
Dsec\GM25419-PA 271 GM25419-PA 98..195 70..182 140 30.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12658-PA 297 GD12658-PA 152..297 38..183 746 93.2 Plus
Dsim\GD12659-PA 301 GD12659-PA 156..301 38..183 381 49 Plus
Dsim\GD14449-PA 271 GD14449-PA 124..271 36..183 373 44.6 Plus
Dsim\GD12557-PA 279 GD12557-PA 143..261 64..176 152 31.1 Plus
Dsim\GD14449-PA 271 GD14449-PA 98..195 70..182 140 30.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13586-PA 283 GJ13586-PA 138..282 38..182 487 57.9 Plus
Dvir\GJ13587-PA 257 GJ13587-PA 112..257 38..183 419 51.4 Plus
Dvir\GJ11769-PA 280 GJ11769-PA 135..278 38..181 402 46.5 Plus
Dvir\GJ17929-PA 313 GJ17929-PA 33..188 20..183 150 29.6 Plus
Dvir\GJ11451-PA 268 GJ11451-PA 142..252 64..176 144 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17093-PA 255 GK17093-PA 105..252 38..183 487 60.8 Plus
Dwil\GK17094-PA 344 GK17094-PA 199..342 38..181 379 48.6 Plus
Dwil\GK17084-PA 260 GK17084-PA 115..258 38..181 364 43.8 Plus
Dwil\GK10520-PA 286 GK10520-PA 146..266 64..176 142 28.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20061-PA 301 GE20061-PA 156..301 38..183 699 88.4 Plus
Dyak\GE20062-PA 301 GE20062-PA 156..301 38..183 377 49 Plus
Dyak\GE21970-PA 268 GE21970-PA 121..268 36..183 366 43.9 Plus
Dyak\GE19843-PA 277 GE19843-PA 139..259 62..176 149 30.6 Plus
Dyak\GE22842-PA 277 GE22842-PA 139..259 62..176 149 30.6 Plus
Dyak\GE21970-PA 268 GE21970-PA 95..192 70..182 144 30.1 Plus