Clone IP06710 Report

Search the DGRC for IP06710

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:67
Well:10
Vector:pOT2
Associated Gene/TranscriptDpy-30L2-RA
Protein status:IP06710.pep: gold
Preliminary Size:538
Sequenced Size:552

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11591 2005-01-01 Successful iPCR screen
CG11591 2008-04-29 Release 5.5 accounting
CG11591 2008-08-15 Release 5.9 accounting
CG11591 2008-12-18 5.12 accounting

Clone Sequence Records

IP06710.complete Sequence

552 bp (552 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023602

> IP06710.complete
CAGTTAGAACTCTGTTCGAATAAAAAAACAAAAAAAATTTATATATTTTT
TAAATAAAGCCCAACAATGCCGGTTTCCCCTGGAGAGGGGGAAGTCAATG
GCGGCGGAGATGTGGCCAAGAACGACTCCAACTCGCAGCAATCGGTGGAT
GGAATCGATGCGTTCGCCGCCTGCCAGAAGCCGCGTCCGGACACCAGTTC
CATGCCGGTTCGCCAGTACCTCGACCAGACGGTGGCCCCCATTTTGCTGC
ACGGACTGCAGGCTTTGGCCCGGGATCGCCCCAGTGATCCGATCAGCTAC
CTGGCCACCTATCTGCTGAAGAACAAGAACCGCTGCGATGAGGTCAAGAC
AGAAGAAAACTAGTTACCCTTGGCTTGTGCTCCCTTGTTTTAGTTTTTAT
TTTTTTTTTTGTCCCTTATCACGACGAACTGTTGCCGATTTTAGGTTTCG
CACACCAAAAATTACTCTTGTACACAACTTATCGCTGATTACAACTGAAG
GCCACTTACCAGCCACGATTTCATGGTGAAAAAAAAAAAAAAAAAAAAAA
AA

IP06710.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-RA 538 Dpy-30L2-RA 22..538 1..516 2545 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4046374..4046844 528..58 2355 100 Minus
chr3L 24539361 chr3L 4046979..4047038 59..1 250 98.3 Minus
chr2L 23010047 chr2L 10731819..10731926 214..321 180 77.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4046987..4047458 529..58 2360 100 Minus
3L 28110227 3L 4047593..4047652 59..1 250 98.3 Minus
2L 23513712 2L 10733055..10733162 214..321 180 77.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4046987..4047458 529..58 2360 100 Minus
3L 28103327 3L 4047593..4047652 59..1 260 98.3 Minus
Blast to na_te.dros performed 2019-03-16 02:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Tc1 1666 Tc1 TC1 1666bp 32..86 1..54 110 69.1 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 3931..3966 20..54 105 80.6 Plus

IP06710.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:55:46 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4046374..4046844 58..528 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:26 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11591-RA 1..297 67..363 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:22 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 1..297 67..363 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:54 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 1..297 67..363 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:16:00 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11591-RA 1..297 67..363 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:24:33 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 1..297 67..363 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:13:08 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11591-RA 22..538 1..516 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:22 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 22..538 1..516 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:54 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 22..550 1..528 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:16:01 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
CG11591-RA 22..538 1..516 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:24:33 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
Dpy-30L2-RA 22..550 1..528 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:46 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4046988..4047456 60..528 100 <- Minus
3L 4047593..4047652 1..59 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:46 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4046988..4047456 60..528 100 <- Minus
3L 4047593..4047652 1..59 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:55:46 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4046988..4047456 60..528 100 <- Minus
3L 4047593..4047652 1..59 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:54 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4046988..4047456 60..528 100 <- Minus
arm_3L 4047593..4047652 1..59 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:52 Download gff for IP06710.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4046988..4047456 60..528 100 <- Minus
3L 4047593..4047652 1..59 98   Minus

IP06710.hyp Sequence

Translation from 66 to 362

> IP06710.hyp
MPVSPGEGEVNGGGDVAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQ
YLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKNRCDEVKTEEN*

IP06710.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-PB 98 CG11591-PB 1..98 1..98 512 100 Plus
Dpy-30L2-PA 98 CG11591-PA 1..98 1..98 512 100 Plus
Dpy-30L1-PA 134 CG6444-PA 64..122 34..92 226 67.8 Plus

IP06710.pep Sequence

Translation from 66 to 362

> IP06710.pep
MPVSPGEGEVNGGGDVAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQ
YLDQTVAPILLHGLQALARDRPSDPISYLATYLLKNKNRCDEVKTEEN*

IP06710.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24410-PA 99 GF24410-PA 4..98 6..97 354 71.6 Plus
Dana\GF15823-PA 120 GF15823-PA 29..110 10..92 219 50.6 Plus
Dana\GF24185-PA 117 GF24185-PA 67..109 49..91 141 55.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14226-PA 98 GG14226-PA 1..98 1..98 469 89.8 Plus
Dere\GG23672-PA 132 GG23672-PA 64..122 34..92 233 67.8 Plus
Dere\GG15990-PA 140 GG15990-PA 68..132 29..91 140 43.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17006-PA 87 GH17006-PA 15..87 24..96 255 58.9 Plus
Dgri\GH10119-PA 87 GH10119-PA 20..87 29..96 245 61.8 Plus
Dgri\GH10427-PA 167 GH10427-PA 101..156 37..92 226 69.6 Plus
Dgri\GH15880-PA 121 GH15880-PA 71..113 49..91 136 53.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpy-30L2-PB 98 CG11591-PB 1..98 1..98 512 100 Plus
Dpy-30L2-PA 98 CG11591-PA 1..98 1..98 512 100 Plus
Dpy-30L1-PA 134 CG6444-PA 64..122 34..92 226 67.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11421-PA 91 GI11421-PA 29..89 36..96 287 83.6 Plus
Dmoj\GI23495-PA 158 GI23495-PA 98..155 40..96 215 69 Plus
Dmoj\GI16531-PA 131 GI16531-PA 63..123 31..91 149 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16811-PA 122 GL16811-PA 23..120 6..96 284 60.2 Plus
Dper\GL26631-PA 123 GL26631-PA 51..114 32..92 226 64.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11085-PA 122 GA11085-PA 23..120 6..96 290 61.2 Plus
Dpse\GA19598-PA 123 GA19598-PA 51..114 32..92 226 64.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14020-PA 98 GM14020-PA 1..98 1..98 477 90.8 Plus
Dsec\GM18725-PA 133 GM18725-PA 66..124 34..92 234 67.8 Plus
Dsec\GM25622-PA 135 GM25622-PA 63..127 29..91 146 44.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13299-PA 98 GD13299-PA 1..98 1..98 492 93.9 Plus
Dsim\GD23729-PA 134 GD23729-PA 35..124 3..92 238 48.9 Plus
Dsim\GD14626-PA 121 GD14626-PA 49..113 29..91 138 43.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13617-PA 91 GJ13617-PA 29..86 36..93 272 82.8 Plus
Dvir\GJ20701-PA 159 GJ20701-PA 98..151 39..92 225 72.2 Plus
Dvir\GJ12783-PA 127 GJ12783-PA 64..119 36..91 140 46.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18024-PA 109 GK18024-PA 44..108 33..97 284 78.5 Plus
Dwil\GK15480-PA 147 GK15480-PA 60..109 42..92 206 72.5 Plus
Dwil\GK16563-PA 122 GK16563-PA 30..114 1..91 143 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20654-PA 98 GE20654-PA 1..98 1..98 470 88.8 Plus
Dyak\GE18485-PA 132 GE18485-PA 64..122 34..92 235 67.8 Plus
Dyak\GE23100-PA 130 GE23100-PA 54..122 22..91 137 38.6 Plus
Dyak\GE19555-PA 130 GE19555-PA 60..122 31..91 135 42.9 Plus