IP06720.complete Sequence
630 bp (630 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023600
> IP06720.complete
TTCTCCATCCGAGCAGATCATAACCAACCTGCAAAATGTTCACCGAAACC
GCTCTTGTTTCCAACTTCAATGGAGTGACAGAGAAGAAATCTCTTACCGG
CGCCTCCACCAACCTGAAGAAGCTGCTGAAGACCATCAAGAAGGTCTTCA
AGAACTCCAAGCCTTCGAAGGAGATTCCGATCCCCAACATCATCTACTCT
TGCAATACTGAGGAGGAGCACCAGAATTGGCTCAACGAACAACTGGAGGC
CATGGCAATCCATCTTCACTGAGTTCTTCTGGGACATCCCCCTCCATCGA
GTATCTGTGATGTGACCCGATCAAAAGGTCTATAAATCGGCACTCCGGCT
TTAATATCCAACTGTGATGACGAGAACACAAGACTGACTGACTTGTGTGC
CTTGGAGGTGACAAAGTTCGTCGCCTCTGCCAACTGTACATATCAAACTA
GCTGCTAAAATGTCTTCAATTATGCTTTAATGTAGTCTAAGTTAGTATTA
TCATTGTCTTCCATTAGTTTAAGAAAATCATTGTCTTCCATGTTTGTTTG
TTAGGGTAAAAAAAACTAGCTTAAGAATAAAAATCCCTCGCGGAAAGAAA
ACAATAAAAAAAAAAAAAAAAAAAAAAAAA
IP06720.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:50:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BobA-RA | 614 | BobA-RA | 6..614 | 1..605 | 2960 | 99.3 | Plus |
CG13465-RA | 237 | CG13465-RA | 1..237 | 36..272 | 1140 | 98.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:25:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 14935555..14936163 | 605..1 | 2920 | 99 | Minus |
chr3L | 24539361 | chr3L | 14933795..14934387 | 590..1 | 2780 | 98.7 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14945498..14946107 | 606..1 | 2955 | 99.3 | Minus |
3L | 28110227 | 3L | 14943739..14944331 | 590..1 | 2765 | 98.5 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 14938598..14939207 | 606..1 | 2965 | 99.3 | Minus |
3L | 28103327 | 3L | 14936839..14937431 | 590..1 | 2785 | 98.4 | Minus |
Blast to na_te.dros performed on 2019-03-15 20:25:39 has no hits.
IP06720.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:26:44 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 14935555..14936163 | 1..605 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:29 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 1..237 | 36..272 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:29 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 1..237 | 36..272 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:13 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 1..237 | 36..272 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:30 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 1..237 | 36..272 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:47 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 1..237 | 36..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:33 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 6..614 | 1..605 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:29 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 6..614 | 1..605 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:13 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 19..627 | 1..605 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:30 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 6..614 | 1..605 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:47 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
BobA-RA | 19..627 | 1..605 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:44 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14945499..14946107 | 1..605 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:44 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14945499..14946107 | 1..605 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:44 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14945499..14946107 | 1..605 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:13 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14938599..14939207 | 1..605 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:33 Download gff for
IP06720.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14938599..14939207 | 1..605 | 99 | | Minus |
IP06720.hyp Sequence
Translation from 35 to 271
> IP06720.hyp
MFTETALVSNFNGVTEKKSLTGASTNLKKLLKTIKKVFKNSKPSKEIPIP
NIIYSCNTEEEHQNWLNEQLEAMAIHLH*
IP06720.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BobA-PA | 78 | CG12487-PA | 1..78 | 1..78 | 403 | 100 | Plus |
CG13465-PA | 78 | CG13465-PA | 1..78 | 1..78 | 394 | 97.4 | Plus |
IP06720.pep Sequence
Translation from 35 to 271
> IP06720.pep
MFTETALVSNFNGVTEKKSLTGASTNLKKLLKTIKKVFKNSKPSKEIPIP
NIIYSCNTEEEHQNWLNEQLEAMAIHLH*
IP06720.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:39:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF25177-PA | 81 | GF25177-PA | 1..79 | 1..77 | 244 | 62 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:39:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13701-PA | 79 | GG13701-PA | 1..77 | 1..77 | 300 | 90.9 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:39:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH16933-PA | 79 | GH16933-PA | 15..79 | 15..78 | 165 | 53.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
BobA-PA | 78 | CG12487-PA | 1..78 | 1..78 | 403 | 100 | Plus |
CG13465-PA | 78 | CG13465-PA | 1..78 | 1..78 | 394 | 97.4 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:39:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI13939-PA | 81 | GI13939-PA | 15..75 | 15..72 | 141 | 50.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:39:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25996-PA | 77 | GL25996-PA | 1..77 | 1..78 | 203 | 54.4 | Plus |
Dper\GL25974-PA | 77 | GL25974-PA | 1..77 | 1..78 | 203 | 54.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:39:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24520-PA | 79 | GM24520-PA | 1..77 | 1..77 | 285 | 88.3 | Plus |
Dsec\GM24522-PA | 78 | GM24522-PA | 1..77 | 1..77 | 278 | 85.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:39:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12591-PA | 79 | GD12591-PA | 1..77 | 1..77 | 309 | 92.2 | Plus |
Dsim\GD12592-PA | 58 | GD12592-PA | 1..52 | 1..52 | 168 | 88.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:39:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ13728-PA | 80 | GJ13728-PA | 16..80 | 16..78 | 135 | 49.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:39:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19996-PA | 79 | GE19996-PA | 1..78 | 1..78 | 291 | 87.2 | Plus |
Dyak\GE19995-PA | 79 | GE19995-PA | 1..78 | 1..78 | 291 | 87.2 | Plus |