Clone IP06720 Report

Search the DGRC for IP06720

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:67
Well:20
Vector:pOT2
Associated Gene/TranscriptBobA-RA
Protein status:IP06720.pep: gold
Preliminary Size:614
Sequenced Size:630

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12487 2005-01-01 Successful iPCR screen
BobA 2008-04-29 Release 5.5 accounting
BobA 2008-08-15 Release 5.9 accounting
BobA 2008-12-18 5.12 accounting

Clone Sequence Records

IP06720.complete Sequence

630 bp (630 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023600

> IP06720.complete
TTCTCCATCCGAGCAGATCATAACCAACCTGCAAAATGTTCACCGAAACC
GCTCTTGTTTCCAACTTCAATGGAGTGACAGAGAAGAAATCTCTTACCGG
CGCCTCCACCAACCTGAAGAAGCTGCTGAAGACCATCAAGAAGGTCTTCA
AGAACTCCAAGCCTTCGAAGGAGATTCCGATCCCCAACATCATCTACTCT
TGCAATACTGAGGAGGAGCACCAGAATTGGCTCAACGAACAACTGGAGGC
CATGGCAATCCATCTTCACTGAGTTCTTCTGGGACATCCCCCTCCATCGA
GTATCTGTGATGTGACCCGATCAAAAGGTCTATAAATCGGCACTCCGGCT
TTAATATCCAACTGTGATGACGAGAACACAAGACTGACTGACTTGTGTGC
CTTGGAGGTGACAAAGTTCGTCGCCTCTGCCAACTGTACATATCAAACTA
GCTGCTAAAATGTCTTCAATTATGCTTTAATGTAGTCTAAGTTAGTATTA
TCATTGTCTTCCATTAGTTTAAGAAAATCATTGTCTTCCATGTTTGTTTG
TTAGGGTAAAAAAAACTAGCTTAAGAATAAAAATCCCTCGCGGAAAGAAA
ACAATAAAAAAAAAAAAAAAAAAAAAAAAA

IP06720.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-RA 614 BobA-RA 6..614 1..605 2960 99.3 Plus
CG13465-RA 237 CG13465-RA 1..237 36..272 1140 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14935555..14936163 605..1 2920 99 Minus
chr3L 24539361 chr3L 14933795..14934387 590..1 2780 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14945498..14946107 606..1 2955 99.3 Minus
3L 28110227 3L 14943739..14944331 590..1 2765 98.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14938598..14939207 606..1 2965 99.3 Minus
3L 28103327 3L 14936839..14937431 590..1 2785 98.4 Minus
Blast to na_te.dros performed on 2019-03-15 20:25:39 has no hits.

IP06720.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:26:44 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14935555..14936163 1..605 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:29 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 1..237 36..272 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:29 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 1..237 36..272 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:13 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 1..237 36..272 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:30 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 1..237 36..272 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:47 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 1..237 36..272 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:33 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 6..614 1..605 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:29 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 6..614 1..605 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:13 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 19..627 1..605 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:30 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 6..614 1..605 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:47 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 19..627 1..605 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:44 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14945499..14946107 1..605 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:44 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14945499..14946107 1..605 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:26:44 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14945499..14946107 1..605 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:13 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14938599..14939207 1..605 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:33 Download gff for IP06720.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14938599..14939207 1..605 99   Minus

IP06720.hyp Sequence

Translation from 35 to 271

> IP06720.hyp
MFTETALVSNFNGVTEKKSLTGASTNLKKLLKTIKKVFKNSKPSKEIPIP
NIIYSCNTEEEHQNWLNEQLEAMAIHLH*

IP06720.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-PA 78 CG12487-PA 1..78 1..78 403 100 Plus
CG13465-PA 78 CG13465-PA 1..78 1..78 394 97.4 Plus

IP06720.pep Sequence

Translation from 35 to 271

> IP06720.pep
MFTETALVSNFNGVTEKKSLTGASTNLKKLLKTIKKVFKNSKPSKEIPIP
NIIYSCNTEEEHQNWLNEQLEAMAIHLH*

IP06720.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25177-PA 81 GF25177-PA 1..79 1..77 244 62 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13701-PA 79 GG13701-PA 1..77 1..77 300 90.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16933-PA 79 GH16933-PA 15..79 15..78 165 53.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-PA 78 CG12487-PA 1..78 1..78 403 100 Plus
CG13465-PA 78 CG13465-PA 1..78 1..78 394 97.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13939-PA 81 GI13939-PA 15..75 15..72 141 50.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25996-PA 77 GL25996-PA 1..77 1..78 203 54.4 Plus
Dper\GL25974-PA 77 GL25974-PA 1..77 1..78 203 54.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24520-PA 79 GM24520-PA 1..77 1..77 285 88.3 Plus
Dsec\GM24522-PA 78 GM24522-PA 1..77 1..77 278 85.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12591-PA 79 GD12591-PA 1..77 1..77 309 92.2 Plus
Dsim\GD12592-PA 58 GD12592-PA 1..52 1..52 168 88.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13728-PA 80 GJ13728-PA 16..80 16..78 135 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19996-PA 79 GE19996-PA 1..78 1..78 291 87.2 Plus
Dyak\GE19995-PA 79 GE19995-PA 1..78 1..78 291 87.2 Plus