Clone IP06774 Report

Search the DGRC for IP06774

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:67
Well:74
Vector:pOT2
Associated Gene/TranscriptCG14135-RB
Protein status:IP06774.pep: gold
Preliminary Size:618
Sequenced Size:912

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14135 2005-01-01 Successful iPCR screen
CG14135 2008-04-29 Release 5.5 accounting
CG14135 2008-08-15 Release 5.9 accounting
CG14135 2008-12-18 5.12 accounting

Clone Sequence Records

IP06774.complete Sequence

912 bp (912 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022586

> IP06774.complete
AAATGCGCTGCGCTGTAAAAAATTGCGGAAATAATAATCGTATTGCCAAT
AGAACGAAATGGAGATACTTTCACTTCCCCAAAGAAAAGCCAAACCTCCA
AAGGTGGATAGATTTTTGCCAGCGAGATAATATAAACCCCACAACTGCCT
GTATTTGCAATGAGCACTTTGCACCCAATGACTTTGAGCGAAATATGCAA
TACGAATTGGGCTTTAGCCGCAAAAATCCAACAAAACTAAAGCCCGGCTC
ATTTCCGAGTGTGAATGGACCCCAAAAGTTGGCGAAGGAACTGCGAGGAA
GTATCAAAAGGGGCTCCAAAAGTGTTCCCTTAGCTGGGTCTACGAAAATG
TCCAATATAGGCTTTGATCCACACCATGCAGGAACGCAATCCTCGGAAGG
CCACGAAACCATAGAAATCCAACTCTGTGGTTTTAATACAGATATTGAGG
GCTTCGAAGAAGCCGAAGATGACGACTGTCCTTCAGGTCCCCGGCTCGTG
GAAGTAGAAATATTGGATCCTCTTAACCCGCAGTCAAATGCCAAGGATCA
TGTGGAGATAATCGATTCGGAAGGCGACAGTTATGTGAAGCACTTGGAGC
TCGAAATATGCTCCTTAAAGCGTGAGGTATTTTTCCTCAAAGACGAATAC
CAGAAGATAAAGGCTGAAATGCGTAATCTCAAGGACACAATAAAAAGATC
AGAGGAAGAACTCGCAGAAAAACAACTCCAAGGTGTTGTTAAAAGCAGAA
AAAGGAAATCTCAGTTTTGAAAAAGACCAGATATCTACGTAAACATAAAC
GACTGACCAGTTATTAAAAGCTGACATCAAGCGTAATAATATATTATCAA
ATCAGTATCTGAATCCAACAGAATTAAAAATTATGAATTATGAAAAAAAA
AAAAAAAAAAAA

IP06774.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14135-RB 1016 CG14135-RB 122..1016 1..895 4475 100 Plus
CG14135.a 917 CG14135.a 46..777 1..732 3660 100 Plus
CG14135.a 917 CG14135.a 778..917 753..892 700 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11682787..11683251 143..607 2295 99.6 Plus
chr3L 24539361 chr3L 11682584..11682730 1..147 735 100 Plus
chr3L 24539361 chr3L 11683314..11683458 608..752 725 100 Plus
chr3L 24539361 chr3L 11683510..11683645 753..888 650 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11691895..11692359 143..607 2310 99.8 Plus
3L 28110227 3L 11692618..11692765 753..900 740 100 Plus
3L 28110227 3L 11691692..11691838 1..147 735 100 Plus
3L 28110227 3L 11692422..11692566 608..752 725 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11684995..11685459 143..607 2310 99.7 Plus
3L 28103327 3L 11685718..11685865 753..900 740 100 Plus
3L 28103327 3L 11684792..11684938 1..147 735 100 Plus
3L 28103327 3L 11685522..11685666 608..752 725 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:46:09 has no hits.

IP06774.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:55 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11682584..11682730 1..147 100 -> Plus
chr3L 11682792..11683251 148..607 99 -> Plus
chr3L 11683314..11683458 608..752 100 -> Plus
chr3L 11683510..11683651 753..892 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:33 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 1..768 3..770 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:13 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 1..768 3..770 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:42 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 1..768 3..770 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:04 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 1..768 3..770 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:18 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 1..768 3..770 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:33 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 46..937 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:13 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 46..937 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:42 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 46..937 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:04 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 46..937 1..892 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:18 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
CG14135-RB 46..937 1..892 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:55 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691692..11691838 1..147 100 -> Plus
3L 11691900..11692359 148..607 100 -> Plus
3L 11692422..11692566 608..752 100 -> Plus
3L 11692618..11692757 753..892 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:55 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691692..11691838 1..147 100 -> Plus
3L 11691900..11692359 148..607 100 -> Plus
3L 11692422..11692566 608..752 100 -> Plus
3L 11692618..11692757 753..892 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:55 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691692..11691838 1..147 100 -> Plus
3L 11691900..11692359 148..607 100 -> Plus
3L 11692422..11692566 608..752 100 -> Plus
3L 11692618..11692757 753..892 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:42 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11684792..11684938 1..147 100 -> Plus
arm_3L 11685000..11685459 148..607 100 -> Plus
arm_3L 11685522..11685666 608..752 100 -> Plus
arm_3L 11685718..11685857 753..892 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:07 Download gff for IP06774.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11685000..11685459 148..607 100 -> Plus
3L 11685522..11685666 608..752 100 -> Plus
3L 11685718..11685857 753..892 100   Plus
3L 11684792..11684938 1..147 100 -> Plus

IP06774.hyp Sequence

Translation from 2 to 769

> IP06774.hyp
MRCAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRDNINPTTAC
ICNEHFAPNDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGS
IKRGSKSVPLAGSTKMSNIGFDPHHAGTQSSEGHETIEIQLCGFNTDIEG
FEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDSEGDSYVKHLEL
EICSLKREVFFLKDEYQKIKAEMRNLKDTIKRSEEELAEKQLQGVVKSRK
RKSQF*

IP06774.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14135-PB 255 CG14135-PB 1..255 1..255 1365 100 Plus
CG14135-PC 259 CG14135-PC 1..250 1..250 1340 100 Plus

IP06774.pep Sequence

Translation from 2 to 769

> IP06774.pep
MRCAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRDNINPTTAC
ICNEHFAPNDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGS
IKRGSKSVPLAGSTKMSNIGFDPHHAGTQSSEGHETIEIQLCGFNTDIEG
FEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDSEGDSYVKHLEL
EICSLKREVFFLKDEYQKIKAEMRNLKDTIKRSEEELAEKQLQGVVKSRK
RKSQF*

IP06774.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15522-PA 257 GG15522-PA 1..182 65..245 696 75.3 Plus
Dere\GG17237-PA 607 GG17237-PA 1..92 1..91 161 36.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14866-PA 288 GH14866-PA 1..253 1..233 520 47.6 Plus
Dgri\GH21630-PA 320 GH21630-PA 1..196 1..235 208 28.7 Plus
Dgri\GH19508-PA 663 GH19508-PA 1..112 1..108 160 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14135-PB 255 CG14135-PB 1..255 1..255 1365 100 Plus
CG14135-PC 259 CG14135-PC 1..250 1..250 1340 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13719-PA 115 GI13719-PA 6..88 154..231 216 50.6 Plus
Dmoj\GI22985-PA 652 GI22985-PA 1..112 1..108 169 33.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16281-PA 205 GL16281-PA 1..191 65..231 275 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12784-PA 205 GA12784-PA 1..191 65..231 276 35.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25291-PA 257 GM25291-PA 1..185 65..248 831 88.1 Plus
Dsec\GM26116-PA 615 GM26116-PA 1..101 1..96 163 35.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14322-PA 205 GD14322-PA 1..133 116..248 602 87.2 Plus
Dsim\GD20676-PA 611 GD20676-PA 1..101 1..96 158 35 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14062-PA 210 GJ14062-PA 1..188 65..233 337 44.8 Plus
Dvir\GJ21175-PA 317 GJ21175-PA 1..88 1..91 199 46.2 Plus
Dvir\GJ24682-PA 666 GJ24682-PA 1..112 1..108 171 34.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21839-PA 204 GE21839-PA 13..129 128..245 444 75.6 Plus
Dyak\GE24637-PA 612 GE24637-PA 1..97 1..91 151 32.3 Plus