IP06774.complete Sequence
912 bp (912 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022586
> IP06774.complete
AAATGCGCTGCGCTGTAAAAAATTGCGGAAATAATAATCGTATTGCCAAT
AGAACGAAATGGAGATACTTTCACTTCCCCAAAGAAAAGCCAAACCTCCA
AAGGTGGATAGATTTTTGCCAGCGAGATAATATAAACCCCACAACTGCCT
GTATTTGCAATGAGCACTTTGCACCCAATGACTTTGAGCGAAATATGCAA
TACGAATTGGGCTTTAGCCGCAAAAATCCAACAAAACTAAAGCCCGGCTC
ATTTCCGAGTGTGAATGGACCCCAAAAGTTGGCGAAGGAACTGCGAGGAA
GTATCAAAAGGGGCTCCAAAAGTGTTCCCTTAGCTGGGTCTACGAAAATG
TCCAATATAGGCTTTGATCCACACCATGCAGGAACGCAATCCTCGGAAGG
CCACGAAACCATAGAAATCCAACTCTGTGGTTTTAATACAGATATTGAGG
GCTTCGAAGAAGCCGAAGATGACGACTGTCCTTCAGGTCCCCGGCTCGTG
GAAGTAGAAATATTGGATCCTCTTAACCCGCAGTCAAATGCCAAGGATCA
TGTGGAGATAATCGATTCGGAAGGCGACAGTTATGTGAAGCACTTGGAGC
TCGAAATATGCTCCTTAAAGCGTGAGGTATTTTTCCTCAAAGACGAATAC
CAGAAGATAAAGGCTGAAATGCGTAATCTCAAGGACACAATAAAAAGATC
AGAGGAAGAACTCGCAGAAAAACAACTCCAAGGTGTTGTTAAAAGCAGAA
AAAGGAAATCTCAGTTTTGAAAAAGACCAGATATCTACGTAAACATAAAC
GACTGACCAGTTATTAAAAGCTGACATCAAGCGTAATAATATATTATCAA
ATCAGTATCTGAATCCAACAGAATTAAAAATTATGAATTATGAAAAAAAA
AAAAAAAAAAAA
IP06774.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:41:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14135-RB | 1016 | CG14135-RB | 122..1016 | 1..895 | 4475 | 100 | Plus |
CG14135.a | 917 | CG14135.a | 46..777 | 1..732 | 3660 | 100 | Plus |
CG14135.a | 917 | CG14135.a | 778..917 | 753..892 | 700 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:46:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 11682787..11683251 | 143..607 | 2295 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 11682584..11682730 | 1..147 | 735 | 100 | Plus |
chr3L | 24539361 | chr3L | 11683314..11683458 | 608..752 | 725 | 100 | Plus |
chr3L | 24539361 | chr3L | 11683510..11683645 | 753..888 | 650 | 98.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 11691895..11692359 | 143..607 | 2310 | 99.8 | Plus |
3L | 28110227 | 3L | 11692618..11692765 | 753..900 | 740 | 100 | Plus |
3L | 28110227 | 3L | 11691692..11691838 | 1..147 | 735 | 100 | Plus |
3L | 28110227 | 3L | 11692422..11692566 | 608..752 | 725 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 11684995..11685459 | 143..607 | 2310 | 99.7 | Plus |
3L | 28103327 | 3L | 11685718..11685865 | 753..900 | 740 | 100 | Plus |
3L | 28103327 | 3L | 11684792..11684938 | 1..147 | 735 | 100 | Plus |
3L | 28103327 | 3L | 11685522..11685666 | 608..752 | 725 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 15:46:09 has no hits.
IP06774.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:55 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 11682584..11682730 | 1..147 | 100 | -> | Plus |
chr3L | 11682792..11683251 | 148..607 | 99 | -> | Plus |
chr3L | 11683314..11683458 | 608..752 | 100 | -> | Plus |
chr3L | 11683510..11683651 | 753..892 | 97 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:33 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 1..768 | 3..770 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:13 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 1..768 | 3..770 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:42 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 1..768 | 3..770 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:54:04 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 1..768 | 3..770 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:18 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 1..768 | 3..770 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:33 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 46..937 | 1..892 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:13 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 46..937 | 1..892 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:42 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 46..937 | 1..892 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:54:04 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 46..937 | 1..892 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:18 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14135-RB | 46..937 | 1..892 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:55 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11691692..11691838 | 1..147 | 100 | -> | Plus |
3L | 11691900..11692359 | 148..607 | 100 | -> | Plus |
3L | 11692422..11692566 | 608..752 | 100 | -> | Plus |
3L | 11692618..11692757 | 753..892 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:55 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11691692..11691838 | 1..147 | 100 | -> | Plus |
3L | 11691900..11692359 | 148..607 | 100 | -> | Plus |
3L | 11692422..11692566 | 608..752 | 100 | -> | Plus |
3L | 11692618..11692757 | 753..892 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:55 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11691692..11691838 | 1..147 | 100 | -> | Plus |
3L | 11691900..11692359 | 148..607 | 100 | -> | Plus |
3L | 11692422..11692566 | 608..752 | 100 | -> | Plus |
3L | 11692618..11692757 | 753..892 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:42 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 11684792..11684938 | 1..147 | 100 | -> | Plus |
arm_3L | 11685000..11685459 | 148..607 | 100 | -> | Plus |
arm_3L | 11685522..11685666 | 608..752 | 100 | -> | Plus |
arm_3L | 11685718..11685857 | 753..892 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:29:07 Download gff for
IP06774.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 11685000..11685459 | 148..607 | 100 | -> | Plus |
3L | 11685522..11685666 | 608..752 | 100 | -> | Plus |
3L | 11685718..11685857 | 753..892 | 100 | | Plus |
3L | 11684792..11684938 | 1..147 | 100 | -> | Plus |
IP06774.hyp Sequence
Translation from 2 to 769
> IP06774.hyp
MRCAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRDNINPTTAC
ICNEHFAPNDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGS
IKRGSKSVPLAGSTKMSNIGFDPHHAGTQSSEGHETIEIQLCGFNTDIEG
FEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDSEGDSYVKHLEL
EICSLKREVFFLKDEYQKIKAEMRNLKDTIKRSEEELAEKQLQGVVKSRK
RKSQF*
IP06774.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:00:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14135-PB | 255 | CG14135-PB | 1..255 | 1..255 | 1365 | 100 | Plus |
CG14135-PC | 259 | CG14135-PC | 1..250 | 1..250 | 1340 | 100 | Plus |
IP06774.pep Sequence
Translation from 2 to 769
> IP06774.pep
MRCAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRDNINPTTAC
ICNEHFAPNDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGS
IKRGSKSVPLAGSTKMSNIGFDPHHAGTQSSEGHETIEIQLCGFNTDIEG
FEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDSEGDSYVKHLEL
EICSLKREVFFLKDEYQKIKAEMRNLKDTIKRSEEELAEKQLQGVVKSRK
RKSQF*
IP06774.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:45:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15522-PA | 257 | GG15522-PA | 1..182 | 65..245 | 696 | 75.3 | Plus |
Dere\GG17237-PA | 607 | GG17237-PA | 1..92 | 1..91 | 161 | 36.2 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:45:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH14866-PA | 288 | GH14866-PA | 1..253 | 1..233 | 520 | 47.6 | Plus |
Dgri\GH21630-PA | 320 | GH21630-PA | 1..196 | 1..235 | 208 | 28.7 | Plus |
Dgri\GH19508-PA | 663 | GH19508-PA | 1..112 | 1..108 | 160 | 33.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14135-PB | 255 | CG14135-PB | 1..255 | 1..255 | 1365 | 100 | Plus |
CG14135-PC | 259 | CG14135-PC | 1..250 | 1..250 | 1340 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:45:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI13719-PA | 115 | GI13719-PA | 6..88 | 154..231 | 216 | 50.6 | Plus |
Dmoj\GI22985-PA | 652 | GI22985-PA | 1..112 | 1..108 | 169 | 33.3 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:45:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL16281-PA | 205 | GL16281-PA | 1..191 | 65..231 | 275 | 35.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:45:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12784-PA | 205 | GA12784-PA | 1..191 | 65..231 | 276 | 35.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:45:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25291-PA | 257 | GM25291-PA | 1..185 | 65..248 | 831 | 88.1 | Plus |
Dsec\GM26116-PA | 615 | GM26116-PA | 1..101 | 1..96 | 163 | 35.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:45:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14322-PA | 205 | GD14322-PA | 1..133 | 116..248 | 602 | 87.2 | Plus |
Dsim\GD20676-PA | 611 | GD20676-PA | 1..101 | 1..96 | 158 | 35 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:45:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ14062-PA | 210 | GJ14062-PA | 1..188 | 65..233 | 337 | 44.8 | Plus |
Dvir\GJ21175-PA | 317 | GJ21175-PA | 1..88 | 1..91 | 199 | 46.2 | Plus |
Dvir\GJ24682-PA | 666 | GJ24682-PA | 1..112 | 1..108 | 171 | 34.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:45:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21839-PA | 204 | GE21839-PA | 13..129 | 128..245 | 444 | 75.6 | Plus |
Dyak\GE24637-PA | 612 | GE24637-PA | 1..97 | 1..91 | 151 | 32.3 | Plus |