Clone IP06786 Report

Search the DGRC for IP06786

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:67
Well:86
Vector:pOT2
Associated Gene/TranscriptCheA87a-RA
Protein status:IP06786.pep: validated not full length
Preliminary Size:552
Sequenced Size:642

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14379 2005-01-01 Successful iPCR screen
CheA87a 2008-04-29 Release 5.5 accounting
CheA87a 2008-08-15 Release 5.9 accounting
CheA87a 2008-12-18 5.12 accounting

Clone Sequence Records

IP06786.complete Sequence

642 bp (642 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022597

> IP06786.complete
GGCTCCTCTTTATGTCCCGTCTCTTATCTGGCGGTCTTGGCAATTATCGT
CCTAACCAGTAATATTACAGTCCAGGCTAAAAGGACATTCAGGATCCAGA
AATTAGAAAAGGTGACTGAGGATACCTCATATCTGCGCAGTCGTCTGCGT
ATCGCTGAGTCCGAGGAAAATGAGTTGAAAGTCAGCGGATATCTCGATCT
GAATCAACGACTCGACAATGATTGGACGGTTGTGCTTAAGGTTTCAAGAT
CCCCGGATAGCGATGGAGACTACGAGAAGGTTTTGACATTCGAAATGCAG
CTTTGCGACTTTATGAAGAGCTACTACAAGGATATCTTTTACGAACGGAT
CAAGGAATACTCGAATGCCCCGCATCCCAGCAGCTGTCCTCTGCCCAAGG
AACGCTATGTACTAGAGGACTATCCCTTCAATGTCAAGTTGCTCAAAAAG
CTGATGAGTCCGGGCTTCTATCGCATAAAGTATACCCTCAAGAATGAAGA
GACTAAAATATTATCGTACGTTCTGGATTTGGAGTTGGAGGAGAACTAAT
CAATCTCGAAATTTGCTAGCTCAAATGCTCCGTTTATTGCCTGAAAAATA
AATCTATTCGTAGGATTGCAAAAAAAAAAAAAAAAAAAAAAA

IP06786.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
CheA87a-RA 663 CheA87a-RA 44..663 1..620 3100 100 Plus
Lip3-RA 1436 Lip3-RA 1327..1436 620..511 550 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9195137..9195528 228..619 1915 99.2 Plus
chr3R 27901430 chr3R 9194854..9195083 1..230 1135 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13369955..13370347 228..620 1965 100 Plus
3R 32079331 3R 13369672..13369901 1..230 1150 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13110786..13111178 228..620 1965 100 Plus
3R 31820162 3R 13110503..13110732 1..230 1150 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:03:47 has no hits.

IP06786.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:04:36 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9194854..9195081 1..228 99 -> Plus
chr3R 9195138..9195528 229..619 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:38 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..552 1..549 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:56 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..552 1..549 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:22 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..552 1..549 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:47 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..552 1..549 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:28:56 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..552 1..549 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:07 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..622 1..619 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:56 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..622 1..619 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:22 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 25..643 1..619 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:47 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 4..622 1..619 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:28:56 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
CheA87a-RA 25..643 1..619 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:36 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13369672..13369899 1..228 100 -> Plus
3R 13369956..13370346 229..619 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:36 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13369672..13369899 1..228 100 -> Plus
3R 13369956..13370346 229..619 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:36 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13369672..13369899 1..228 100 -> Plus
3R 13369956..13370346 229..619 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:22 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9195394..9195621 1..228 100 -> Plus
arm_3R 9195678..9196068 229..619 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:50 Download gff for IP06786.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13110503..13110730 1..228 100 -> Plus
3R 13110787..13111177 229..619 100   Plus

IP06786.pep Sequence

Translation from 0 to 548

> IP06786.pep
GSSLCPVSYLAVLAIIVLTSNITVQAKRTFRIQKLEKVTEDTSYLRSRLR
IAESEENELKVSGYLDLNQRLDNDWTVVLKVSRSPDSDGDYEKVLTFEMQ
LCDFMKSYYKDIFYERIKEYSNAPHPSSCPLPKERYVLEDYPFNVKLLKK
LMSPGFYRIKYTLKNEETKILSYVLDLELEEN*

IP06786.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17596-PA 183 GF17596-PA 26..183 24..180 391 46.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19621-PA 183 GG19621-PA 2..183 1..182 792 81.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19041-PA 184 GH19041-PA 7..184 9..180 301 37.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
CheA87a-PA 183 CG14379-PA 2..183 1..182 934 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24335-PA 179 GI24335-PA 9..170 13..170 244 34 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24470-PA 185 GL24470-PA 23..185 19..180 398 47.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12944-PA 185 GA12944-PA 23..185 19..180 401 47.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24104-PA 183 GM24104-PA 2..183 1..182 879 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18903-PA 183 GD18903-PA 2..183 1..182 876 90.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10420-PA 178 GJ10420-PA 3..178 8..180 261 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13939-PA 179 GK13939-PA 4..178 8..179 354 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26267-PA 183 GE26267-PA 2..182 1..181 732 79 Plus

IP06786.hyp Sequence

Translation from 0 to 548

> IP06786.hyp
GSSLCPVSYLAVLAIIVLTSNITVQAKRTFRIQKLEKVTEDTSYLRSRLR
IAESEENELKVSGYLDLNQRLDNDWTVVLKVSRSPDSDGDYEKVLTFEMQ
LCDFMKSYYKDIFYERIKEYSNAPHPSSCPLPKERYVLEDYPFNVKLLKK
LMSPGFYRIKYTLKNEETKILSYVLDLELEEN*

IP06786.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:00:57
Subject Length Description Subject Range Query Range Score Percent Strand
CheA87a-PA 183 CG14379-PA 2..183 1..182 934 100 Plus