BDGP Sequence Production Resources |
Search the DGRC for IP06786
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 67 |
Well: | 86 |
Vector: | pOT2 |
Associated Gene/Transcript | CheA87a-RA |
Protein status: | IP06786.pep: validated not full length |
Preliminary Size: | 552 |
Sequenced Size: | 642 |
Gene | Date | Evidence |
---|---|---|
CG14379 | 2005-01-01 | Successful iPCR screen |
CheA87a | 2008-04-29 | Release 5.5 accounting |
CheA87a | 2008-08-15 | Release 5.9 accounting |
CheA87a | 2008-12-18 | 5.12 accounting |
642 bp (642 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022597
> IP06786.complete GGCTCCTCTTTATGTCCCGTCTCTTATCTGGCGGTCTTGGCAATTATCGT CCTAACCAGTAATATTACAGTCCAGGCTAAAAGGACATTCAGGATCCAGA AATTAGAAAAGGTGACTGAGGATACCTCATATCTGCGCAGTCGTCTGCGT ATCGCTGAGTCCGAGGAAAATGAGTTGAAAGTCAGCGGATATCTCGATCT GAATCAACGACTCGACAATGATTGGACGGTTGTGCTTAAGGTTTCAAGAT CCCCGGATAGCGATGGAGACTACGAGAAGGTTTTGACATTCGAAATGCAG CTTTGCGACTTTATGAAGAGCTACTACAAGGATATCTTTTACGAACGGAT CAAGGAATACTCGAATGCCCCGCATCCCAGCAGCTGTCCTCTGCCCAAGG AACGCTATGTACTAGAGGACTATCCCTTCAATGTCAAGTTGCTCAAAAAG CTGATGAGTCCGGGCTTCTATCGCATAAAGTATACCCTCAAGAATGAAGA GACTAAAATATTATCGTACGTTCTGGATTTGGAGTTGGAGGAGAACTAAT CAATCTCGAAATTTGCTAGCTCAAATGCTCCGTTTATTGCCTGAAAAATA AATCTATTCGTAGGATTGCAAAAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9194854..9195081 | 1..228 | 99 | -> | Plus |
chr3R | 9195138..9195528 | 229..619 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..552 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..552 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..552 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..552 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..552 | 1..549 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..622 | 1..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..622 | 1..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 25..643 | 1..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 4..622 | 1..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CheA87a-RA | 25..643 | 1..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13369672..13369899 | 1..228 | 100 | -> | Plus |
3R | 13369956..13370346 | 229..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13369672..13369899 | 1..228 | 100 | -> | Plus |
3R | 13369956..13370346 | 229..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13369672..13369899 | 1..228 | 100 | -> | Plus |
3R | 13369956..13370346 | 229..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9195394..9195621 | 1..228 | 100 | -> | Plus |
arm_3R | 9195678..9196068 | 229..619 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13110503..13110730 | 1..228 | 100 | -> | Plus |
3R | 13110787..13111177 | 229..619 | 100 | Plus |
Translation from 0 to 548
> IP06786.pep GSSLCPVSYLAVLAIIVLTSNITVQAKRTFRIQKLEKVTEDTSYLRSRLR IAESEENELKVSGYLDLNQRLDNDWTVVLKVSRSPDSDGDYEKVLTFEMQ LCDFMKSYYKDIFYERIKEYSNAPHPSSCPLPKERYVLEDYPFNVKLLKK LMSPGFYRIKYTLKNEETKILSYVLDLELEEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17596-PA | 183 | GF17596-PA | 26..183 | 24..180 | 391 | 46.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19621-PA | 183 | GG19621-PA | 2..183 | 1..182 | 792 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19041-PA | 184 | GH19041-PA | 7..184 | 9..180 | 301 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CheA87a-PA | 183 | CG14379-PA | 2..183 | 1..182 | 934 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24335-PA | 179 | GI24335-PA | 9..170 | 13..170 | 244 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24470-PA | 185 | GL24470-PA | 23..185 | 19..180 | 398 | 47.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12944-PA | 185 | GA12944-PA | 23..185 | 19..180 | 401 | 47.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24104-PA | 183 | GM24104-PA | 2..183 | 1..182 | 879 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18903-PA | 183 | GD18903-PA | 2..183 | 1..182 | 876 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10420-PA | 178 | GJ10420-PA | 3..178 | 8..180 | 261 | 31.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13939-PA | 179 | GK13939-PA | 4..178 | 8..179 | 354 | 40.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26267-PA | 183 | GE26267-PA | 2..182 | 1..181 | 732 | 79 | Plus |
Translation from 0 to 548
> IP06786.hyp GSSLCPVSYLAVLAIIVLTSNITVQAKRTFRIQKLEKVTEDTSYLRSRLR IAESEENELKVSGYLDLNQRLDNDWTVVLKVSRSPDSDGDYEKVLTFEMQ LCDFMKSYYKDIFYERIKEYSNAPHPSSCPLPKERYVLEDYPFNVKLLKK LMSPGFYRIKYTLKNEETKILSYVLDLELEEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CheA87a-PA | 183 | CG14379-PA | 2..183 | 1..182 | 934 | 100 | Plus |