IP06814.complete Sequence
650 bp (650 high quality bases) assembled on 2006-01-20
GenBank Submission: BT024376
> IP06814.complete
ATATTTGATAAAACACATTTCCCAGTGCCACGACTTTACCAAAATTATTG
AGTTTCCTGATCATCTCGCCCGTGCCGCATAAAATTCGCCTCCATTCCCG
GCATTCCGATGGACTACAGCTATAGCATTGGCTCCAAGTCGCCAGTGTTC
ATCAGCAAATGTGCCCCGTACAACTTTCTGCGGGAATACCGCCTAGGCTG
CGATTGTAAGAATATACCAGCTGTCACACTGGTTAAGGAAGCCCGCAACG
CTTGGCACGCACTCAGTGACCAGGAGCAGTCCTTGTTCGAGGAAGTCCCC
TATTTGATGGCCCAATTCGGACCATCCATCGAGTCGGCAATGAGGTTAAC
CGTCAATGTCCTGTCGCCTCAGCAGGTCACAGTGCAAAGGACGCGCTCTG
ATGTTCAGTCAAGTAAGCGTAGAATCTGTCGTGGAAATGCCAAGACGCAT
AGGAAGAAGCGGCAGCAGAAGATGGGTGCAACGAGCCGGAAGCGAAGTCC
AGGGATTGGAAGTACCAGGTGTACCAGGTATACATCCCAATTTCACTGGG
AAAACCCGCCTCTTTAAAAACCTTGATGAACCCTTTTGACCACCGGATAT
GCTAGCAATGGAAAATATAGGTACACTGCAATCAAAAAAAAAAAAAAAAA
IP06814.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:21:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14835-RA | 659 | CG14835-RA | 27..659 | 1..633 | 3165 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:40:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 7428908..7429540 | 633..1 | 3105 | 99.4 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:40:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7436805..7437440 | 636..1 | 3180 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 7429905..7430540 | 636..1 | 3180 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 20:40:14 has no hits.
IP06814.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:41:17 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 7428908..7429540 | 1..633 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:42 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 1..459 | 109..567 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:57 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 1..459 | 109..567 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:10:02 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 1..459 | 109..567 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:56 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 1..459 | 109..567 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:40:54 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 1..459 | 109..567 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:48 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 27..659 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:57 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 27..659 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:10:02 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 27..659 | 1..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:57 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 27..593 | 1..567 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:54 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14835-RA | 27..659 | 1..633 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:17 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7436808..7437440 | 1..633 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:17 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7436808..7437440 | 1..633 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:17 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7436808..7437440 | 1..633 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:10:02 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7429908..7430540 | 1..633 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:01 Download gff for
IP06814.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7429908..7430540 | 1..633 | 100 | | Minus |
IP06814.pep Sequence
Translation from 108 to 566
> IP06814.pep
MDYSYSIGSKSPVFISKCAPYNFLREYRLGCDCKNIPAVTLVKEARNAWH
ALSDQEQSLFEEVPYLMAQFGPSIESAMRLTVNVLSPQQVTVQRTRSDVQ
SSKRRICRGNAKTHRKKRQQKMGATSRKRSPGIGSTRCTRYTSQFHWENP
PL*
IP06814.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:22:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24283-PA | 154 | GF24283-PA | 11..105 | 11..103 | 209 | 45.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:22:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14962-PA | 139 | GG14962-PA | 1..133 | 1..132 | 479 | 67.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14835-PA | 152 | CG14835-PA | 1..152 | 1..152 | 803 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:22:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL23450-PA | 140 | GL23450-PA | 1..86 | 13..98 | 189 | 41.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:22:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA27258-PA | 134 | GA27258-PA | 1..86 | 13..98 | 180 | 40.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:22:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13758-PA | 142 | GM13758-PA | 1..138 | 1..138 | 656 | 89.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:22:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13055-PA | 203 | GD13055-PA | 62..199 | 1..138 | 627 | 87 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:22:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20411-PA | 157 | GE20411-PA | 1..152 | 1..148 | 521 | 68.4 | Plus |
IP06814.hyp Sequence
Translation from 108 to 566
> IP06814.hyp
MDYSYSIGSKSPVFISKCAPYNFLREYRLGCDCKNIPAVTLVKEARNAWH
ALSDQEQSLFEEVPYLMAQFGPSIESAMRLTVNVLSPQQVTVQRTRSDVQ
SSKRRICRGNAKTHRKKRQQKMGATSRKRSPGIGSTRCTRYTSQFHWENP
PL*
IP06814.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:01:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14835-PA | 152 | CG14835-PA | 1..152 | 1..152 | 803 | 100 | Plus |