Clone IP06814 Report

Search the DGRC for IP06814

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:68
Well:14
Vector:pOT2
Associated Gene/TranscriptCG14835-RA
Protein status:IP06814.pep: gold
Preliminary Size:593
Sequenced Size:650

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14835 2005-01-01 Successful iPCR screen
CG14835 2008-04-29 Release 5.5 accounting
CG14835 2008-08-15 Release 5.9 accounting
CG14835 2008-12-18 5.12 accounting

Clone Sequence Records

IP06814.complete Sequence

650 bp (650 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024376

> IP06814.complete
ATATTTGATAAAACACATTTCCCAGTGCCACGACTTTACCAAAATTATTG
AGTTTCCTGATCATCTCGCCCGTGCCGCATAAAATTCGCCTCCATTCCCG
GCATTCCGATGGACTACAGCTATAGCATTGGCTCCAAGTCGCCAGTGTTC
ATCAGCAAATGTGCCCCGTACAACTTTCTGCGGGAATACCGCCTAGGCTG
CGATTGTAAGAATATACCAGCTGTCACACTGGTTAAGGAAGCCCGCAACG
CTTGGCACGCACTCAGTGACCAGGAGCAGTCCTTGTTCGAGGAAGTCCCC
TATTTGATGGCCCAATTCGGACCATCCATCGAGTCGGCAATGAGGTTAAC
CGTCAATGTCCTGTCGCCTCAGCAGGTCACAGTGCAAAGGACGCGCTCTG
ATGTTCAGTCAAGTAAGCGTAGAATCTGTCGTGGAAATGCCAAGACGCAT
AGGAAGAAGCGGCAGCAGAAGATGGGTGCAACGAGCCGGAAGCGAAGTCC
AGGGATTGGAAGTACCAGGTGTACCAGGTATACATCCCAATTTCACTGGG
AAAACCCGCCTCTTTAAAAACCTTGATGAACCCTTTTGACCACCGGATAT
GCTAGCAATGGAAAATATAGGTACACTGCAATCAAAAAAAAAAAAAAAAA

IP06814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14835-RA 659 CG14835-RA 27..659 1..633 3165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7428908..7429540 633..1 3105 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7436805..7437440 636..1 3180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7429905..7430540 636..1 3180 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:40:14 has no hits.

IP06814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:41:17 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7428908..7429540 1..633 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:42 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 1..459 109..567 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:57 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 1..459 109..567 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:10:02 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 1..459 109..567 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:56 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 1..459 109..567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:40:54 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 1..459 109..567 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:48 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 27..659 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:57 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 27..659 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:10:02 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 27..659 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:57 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 27..593 1..567 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:54 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
CG14835-RA 27..659 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:17 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7436808..7437440 1..633 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:17 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7436808..7437440 1..633 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:17 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7436808..7437440 1..633 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:10:02 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7429908..7430540 1..633 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:01 Download gff for IP06814.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7429908..7430540 1..633 100   Minus

IP06814.pep Sequence

Translation from 108 to 566

> IP06814.pep
MDYSYSIGSKSPVFISKCAPYNFLREYRLGCDCKNIPAVTLVKEARNAWH
ALSDQEQSLFEEVPYLMAQFGPSIESAMRLTVNVLSPQQVTVQRTRSDVQ
SSKRRICRGNAKTHRKKRQQKMGATSRKRSPGIGSTRCTRYTSQFHWENP
PL*

IP06814.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24283-PA 154 GF24283-PA 11..105 11..103 209 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14962-PA 139 GG14962-PA 1..133 1..132 479 67.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14835-PA 152 CG14835-PA 1..152 1..152 803 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23450-PA 140 GL23450-PA 1..86 13..98 189 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27258-PA 134 GA27258-PA 1..86 13..98 180 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13758-PA 142 GM13758-PA 1..138 1..138 656 89.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13055-PA 203 GD13055-PA 62..199 1..138 627 87 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20411-PA 157 GE20411-PA 1..152 1..148 521 68.4 Plus

IP06814.hyp Sequence

Translation from 108 to 566

> IP06814.hyp
MDYSYSIGSKSPVFISKCAPYNFLREYRLGCDCKNIPAVTLVKEARNAWH
ALSDQEQSLFEEVPYLMAQFGPSIESAMRLTVNVLSPQQVTVQRTRSDVQ
SSKRRICRGNAKTHRKKRQQKMGATSRKRSPGIGSTRCTRYTSQFHWENP
PL*

IP06814.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14835-PA 152 CG14835-PA 1..152 1..152 803 100 Plus