Clone IP06821 Report

Search the DGRC for IP06821

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:68
Well:21
Vector:pOT2
Associated Gene/TranscriptCG14949-RA
Protein status:IP06821.pep: gold
Preliminary Size:627
Sequenced Size:963

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14949 2005-01-01 Successful iPCR screen
CG14949 2008-04-29 Release 5.5 accounting
CG14949 2008-08-15 Release 5.9 accounting
CG14949 2008-12-18 5.12 accounting

Clone Sequence Records

IP06821.complete Sequence

963 bp (963 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024373

> IP06821.complete
AGCCACCGGAGCCACTATCCCAGCAGAGCTACAGCAGCAGGCCGTATTCC
CTTAGCCCCAAAAAGCCTAAACCTTAAGATGCAGGTCCACCAGGCTGTGT
TTGGAGCCGCCGTGCTCGGCATGCTGTTGGCCATCGGCTGTTCCCTGCCC
GTTTTGGATGCCAGTTCAGGCATCGACAACGCCACCATCGAGGAGCTGAG
GGCCAGCGTCAACGATACGCCCAAGAATCTCTATGTGGTCAAGGCGGTGG
TCTATGAGATCGGCATCCTGACGGAGGTGGGCGAGAATGACACCAGTTTT
GAGAGCCAGGAACGCGTGGATCTGACCTTCTACGACACGCACAGCAACAA
GAGTCACATTGACCTGGGCAACATCCCGCTGCCCATCCAGACCAATGTCA
CCGGTCAAGTGCTGACCGGCATCGCACCCGTGAATCTGGGAGCCTTCAGC
AGCCCCCAGGAACTCCTAGAAACCCTTCCCCTGACCGGAAGCATTGTGAA
CATCACGCACAGCGACACCGCCTTCTATCAACTGAGCAGATCGAACACCA
GTGCCGCGGACAAGCCACAGATTCTGGATCAGGATGCGCTGGCCAAGCTC
ACGCACGCGGCCCAGTTGTTCCCGCCATCGTCGCAAATTGGCCAGTCGGT
GCCAGTGAACCCAGCTGCCGATAACGAGGTGCCCCAGACGGAACCCGAGG
ATTAGGCTTACTCCGCGGAATCTCATCGTGATGCAGTGCGTTGCTCTCCA
AGCAATCTATAAATACGTATACTCTAGATCTACTTAGTTTTATGGCTTCA
CACTTAAGTACCTACAGTGCTAGAAAAGACTGGACGAGGACAAGAGATCG
GCAACATTGCCGTGGTCACATCACAAGGTTGGAATTTCACTTTTCTATGG
CAAAGTAAAAATAAATTTCGCATTAGTGCTAGGTAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

IP06821.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14949-RA 1240 CG14949-RA 172..1108 1..937 4685 100 Plus
CG14949.a 946 CG14949.a 1..877 1..877 4385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2641694..2642397 934..231 3520 100 Minus
chr3L 24539361 chr3L 2642705..2642934 230..1 1150 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2642181..2642887 937..231 3535 100 Minus
3L 28110227 3L 2643195..2643424 230..1 1150 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2642181..2642887 937..231 3535 100 Minus
3L 28103327 3L 2643195..2643424 230..1 1150 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:10:05 has no hits.

IP06821.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:10:44 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2641694..2642397 231..934 100 <- Minus
chr3L 2642705..2642934 1..230 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:43 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..627 79..705 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:39 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..627 79..705 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:33 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..627 79..705 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:51 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..627 79..705 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:51 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..627 79..705 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:05 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..627 79..705 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:38 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..934 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:33 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..934 1..934 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:52 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..627 79..705 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:51 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
CG14949-RA 1..934 1..934 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:44 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2642184..2642887 231..934 100 <- Minus
3L 2643195..2643424 1..230 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:44 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2642184..2642887 231..934 100 <- Minus
3L 2643195..2643424 1..230 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:44 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2642184..2642887 231..934 100 <- Minus
3L 2643195..2643424 1..230 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:33 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2642184..2642887 231..934 100 <- Minus
arm_3L 2643195..2643424 1..230 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:02 Download gff for IP06821.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2642184..2642887 231..934 100 <- Minus
3L 2643195..2643424 1..230 100   Minus

IP06821.hyp Sequence

Translation from 0 to 704

> IP06821.hyp
SHRSHYPSRATAAGRIPLAPKSLNLKMQVHQAVFGAAVLGMLLAIGCSLP
VLDASSGIDNATIEELRASVNDTPKNLYVVKAVVYEIGILTEVGENDTSF
ESQERVDLTFYDTHSNKSHIDLGNIPLPIQTNVTGQVLTGIAPVNLGAFS
SPQELLETLPLTGSIVNITHSDTAFYQLSRSNTSAADKPQILDQDALAKL
THAAQLFPPSSQIGQSVPVNPAADNEVPQTEPED*

IP06821.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14949-PA 208 CG14949-PA 1..208 27..234 1048 100 Plus

IP06821.pep Sequence

Translation from 78 to 704

> IP06821.pep
MQVHQAVFGAAVLGMLLAIGCSLPVLDASSGIDNATIEELRASVNDTPKN
LYVVKAVVYEIGILTEVGENDTSFESQERVDLTFYDTHSNKSHIDLGNIP
LPIQTNVTGQVLTGIAPVNLGAFSSPQELLETLPLTGSIVNITHSDTAFY
QLSRSNTSAADKPQILDQDALAKLTHAAQLFPPSSQIGQSVPVNPAADNE
VPQTEPED*

IP06821.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10246-PA 208 GF10246-PA 1..208 1..208 1011 92.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14507-PA 208 GG14507-PA 1..208 1..208 1056 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15070-PA 207 GH15070-PA 1..187 1..187 767 75.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14949-PA 208 CG14949-PA 1..208 1..208 1048 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12838-PA 209 GI12838-PA 5..182 4..181 777 80.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22622-PA 209 GL22622-PA 1..201 1..201 1004 95.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13376-PA 209 GA13376-PA 1..201 1..201 1004 95.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14113-PA 208 GM14113-PA 1..208 1..208 1068 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13381-PA 208 GD13381-PA 1..208 1..208 1061 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12982-PA 203 GJ12982-PA 1..199 1..201 836 79.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12502-PA 214 GK12502-PA 2..202 1..201 921 84.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21697-PA 208 GE21697-PA 1..208 1..208 1064 99 Plus