BDGP Sequence Production Resources |
Search the DGRC for IP06822
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 68 |
Well: | 22 |
Vector: | pOT2 |
Associated Gene/Transcript | CG42324-RH |
Protein status: | IP06822.pep: gold |
Preliminary Size: | 594 |
Sequenced Size: | 987 |
Gene | Date | Evidence |
---|---|---|
CG14972 | 2005-01-01 | Successful iPCR screen |
CG14972 | 2008-04-29 | Release 5.5 accounting |
CG42324 | 2008-08-15 | Release 5.9 accounting |
CG42324 | 2008-12-18 | 5.12 accounting |
987 bp (987 high quality bases) assembled on 2006-09-22
GenBank Submission: BT029056
> IP06822.complete CGAAACCGTGTGACACTCTGCGTCCGGCGGCCACAGCGGGCAACCCGAAA GCGGCAGAGATATCAACTGCAAAATCGGCAATATCCACGGCGACGGCAGC ACCGGCTATAGCTGCCACGCCCCTTGCCACATCCGCCCCCGCAGCAGCGG AAATCGAGCAGCTGCAACAGGCGTTAATCGAGAAACAAACGCAACTGTAT GCCCTGGAATCGGCCTGTTTGAGGGAAACGGAACGACAAGTGGAGCTCGA GGATAGTGTGATAGCGTGGCAGGATAAGTACGATCGGCTCTACGAATCGC ACAAGCGGGTTCAAAAGGTCAATCAGAGCCTGGAGGACAAGATGCTCAAG CTGGTGGATCGAAATGCCGGCGAAAGGGCACAGTTGACCAGCGATGTGGC CACTTTGAGTGTGCGACTCGCCCAGGCAAACTTCAACATCGCCAAGCTGC AGAGGGAAATCGAACGCTACAAGGCCGACATTAGCCTGGCCATCCAATTG CTGCAGTGCAAGCCGGATAGTTTTGTGTCCCAGAAAGTGTCATCGCTACC CATTGATATTCAGTCGAAGGTGTCGGCGTACATGAGACTGGAGACGAACT CCCACTCCGATTCCGAGTGCAGCAATAGTGGAGTTGGCGTGGCCACCACA GCTTCCTACAAAGTGCTTCCGGCCTCCGATTCGCCGCCCCCATCCGCCTG CCCCTTCCCGCCCACGGCCATGGTGTATTCGATGAGGGGAATCGGTAGGT GTTAGTAGACCATGTTGAGCCTTATGATTTTTTTTCTCATTTCCGCCTGA TTTCGAATTTTTGATTTATTGATTTACGTTTTCTAGGCAACGGATTCAAT CACGAAGACTGCGTTAAGTTAACAATATGATTTCGTTCCCTTGACTGCAT TTAACAATCATTTTTTGCACTTTCAGCCATCACATATTTTATTTATTGTT CATTGTATTCATTTTATTTGCTACAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42324-RC | 1103 | CG42324-RC | 121..1103 | 1..983 | 4915 | 100 | Plus |
CG42324.b | 1192 | CG42324.b | 235..1192 | 26..983 | 4790 | 100 | Plus |
CG42324.a | 967 | CG42324.a | 77..821 | 1..745 | 3725 | 100 | Plus |
CG42324.a | 967 | CG42324.a | 820..967 | 836..983 | 740 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 3485259..3485695 | 26..462 | 2140 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 3504289..3504718 | 545..974 | 2120 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 3504122..3504205 | 462..545 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2406..2531 | 46..170 | 168 | 60.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3485134..3485159 | 1..26 | 100 | -> | Plus |
chr3L | 3485260..3485694 | 27..461 | 99 | -> | Plus |
chr3L | 3504122..3504205 | 462..545 | 100 | -> | Plus |
chr3L | 3504290..3504718 | 546..974 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RC | 77..831 | 1..755 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RC | 77..831 | 1..755 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RF | 14..750 | 19..755 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RC | 77..831 | 1..755 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RF | 14..750 | 19..755 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RC | 77..1050 | 1..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RC | 77..1050 | 1..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RH | 9..982 | 1..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RC | 77..1050 | 1..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42324-RH | 9..982 | 1..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3485718..3485743 | 1..26 | 100 | -> | Plus |
3L | 3485844..3486278 | 27..461 | 100 | -> | Plus |
3L | 3504720..3504803 | 462..545 | 100 | -> | Plus |
3L | 3504888..3505316 | 546..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3485718..3485743 | 1..26 | 100 | -> | Plus |
3L | 3485844..3486278 | 27..461 | 100 | -> | Plus |
3L | 3504720..3504803 | 462..545 | 100 | -> | Plus |
3L | 3504888..3505316 | 546..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3485718..3485743 | 1..26 | 100 | -> | Plus |
3L | 3485844..3486278 | 27..461 | 100 | -> | Plus |
3L | 3504720..3504803 | 462..545 | 100 | -> | Plus |
3L | 3504888..3505316 | 546..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3485718..3485743 | 1..26 | 100 | -> | Plus |
arm_3L | 3485844..3486278 | 27..461 | 100 | -> | Plus |
arm_3L | 3504720..3504803 | 462..545 | 100 | -> | Plus |
arm_3L | 3504888..3505316 | 546..974 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3485718..3485743 | 1..26 | 100 | -> | Plus |
3L | 3485844..3486278 | 27..461 | 100 | -> | Plus |
3L | 3504720..3504803 | 462..545 | 100 | -> | Plus |
3L | 3504888..3505316 | 546..974 | 100 | Plus |
Translation from 2 to 754
> IP06822.pep KPCDTLRPAATAGNPKAAEISTAKSAISTATAAPAIAATPLATSAPAAAE IEQLQQALIEKQTQLYALESACLRETERQVELEDSVIAWQDKYDRLYESH KRVQKVNQSLEDKMLKLVDRNAGERAQLTSDVATLSVRLAQANFNIAKLQ REIERYKADISLAIQLLQCKPDSFVSQKVSSLPIDIQSKVSAYMRLETNS HSDSECSNSGVGVATTASYKVLPASDSPPPSACPFPPTAMVYSMRGIGRC *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24213-PA | 944 | GF24213-PA | 27..120 | 154..247 | 421 | 100 | Plus |
Dana\GF20071-PA | 83 | GF20071-PA | 1..40 | 114..153 | 193 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15146-PA | 1037 | GG15146-PA | 8..246 | 9..247 | 1215 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16416-PA | 198 | GH16416-PA | 62..165 | 50..153 | 519 | 92.3 | Plus |
Dgri\GH16417-PA | 923 | GH16417-PA | 1..94 | 154..247 | 411 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42324-PF | 249 | CG42324-PF | 8..249 | 9..250 | 1198 | 100 | Plus |
CG42324-PK | 1037 | CG42324-PK | 8..248 | 9..249 | 1189 | 100 | Plus |
CG42324-PJ | 1035 | CG42324-PJ | 8..246 | 9..247 | 1178 | 100 | Plus |
CG42324-PH | 137 | CG42324-PH | 1..137 | 114..250 | 688 | 100 | Plus |
CG42324-PG | 925 | CG42324-PG | 1..136 | 114..249 | 679 | 100 | Plus |
CG42324-PI | 923 | CG42324-PI | 1..134 | 114..247 | 668 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12497-PA | 637 | GI12497-PA | 1..135 | 114..248 | 608 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13252-PA | 477 | GL13252-PA | 6..101 | 152..247 | 407 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28606-PA | 1074 | GA28606-PA | 51..251 | 47..247 | 945 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14578-PA | 185 | GM14578-PA | 26..175 | 1..153 | 759 | 98 | Plus |
Dsec\GM14579-PA | 910 | GM14579-PA | 44..137 | 154..247 | 506 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13770-PA | 194 | GD13770-PA | 27..176 | 1..153 | 755 | 98 | Plus |
Dsim\GD13772-PA | 910 | GD13772-PA | 28..121 | 154..247 | 506 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12401-PA | 158 | GJ12401-PA | 50..153 | 50..153 | 527 | 95.2 | Plus |
Dvir\GJ12402-PA | 947 | GJ12402-PA | 4..97 | 154..247 | 410 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20517-PA | 584 | GK20517-PA | 16..82 | 182..248 | 265 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21369-PA | 1064 | GE21369-PA | 24..267 | 1..247 | 1048 | 91.5 | Plus |
Translation from 2 to 754
> IP06822.hyp KPCDTLRPAATAGNPKAAEISTAKSAISTATAAPAIAATPLATSAPAAAE IEQLQQALIEKQTQLYALESACLRETERQVELEDSVIAWQDKYDRLYESH KRVQKVNQSLEDKMLKLVDRNAGERAQLTSDVATLSVRLAQANFNIAKLQ REIERYKADISLAIQLLQCKPDSFVSQKVSSLPIDIQSKVSAYMRLETNS HSDSECSNSGVGVATTASYKVLPASDSPPPSACPFPPTAMVYSMRGIGRC *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42324-PF | 249 | CG42324-PF | 8..249 | 9..250 | 1198 | 100 | Plus |
CG42324-PK | 1037 | CG42324-PK | 8..248 | 9..249 | 1189 | 100 | Plus |
CG42324-PJ | 1035 | CG42324-PJ | 8..246 | 9..247 | 1178 | 100 | Plus |
CG42324-PH | 137 | CG42324-PH | 1..137 | 114..250 | 688 | 100 | Plus |
CG42324-PG | 925 | CG42324-PG | 1..136 | 114..249 | 679 | 100 | Plus |