Clone IP06822 Report

Search the DGRC for IP06822

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:68
Well:22
Vector:pOT2
Associated Gene/TranscriptCG42324-RH
Protein status:IP06822.pep: gold
Preliminary Size:594
Sequenced Size:987

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14972 2005-01-01 Successful iPCR screen
CG14972 2008-04-29 Release 5.5 accounting
CG42324 2008-08-15 Release 5.9 accounting
CG42324 2008-12-18 5.12 accounting

Clone Sequence Records

IP06822.complete Sequence

987 bp (987 high quality bases) assembled on 2006-09-22

GenBank Submission: BT029056

> IP06822.complete
CGAAACCGTGTGACACTCTGCGTCCGGCGGCCACAGCGGGCAACCCGAAA
GCGGCAGAGATATCAACTGCAAAATCGGCAATATCCACGGCGACGGCAGC
ACCGGCTATAGCTGCCACGCCCCTTGCCACATCCGCCCCCGCAGCAGCGG
AAATCGAGCAGCTGCAACAGGCGTTAATCGAGAAACAAACGCAACTGTAT
GCCCTGGAATCGGCCTGTTTGAGGGAAACGGAACGACAAGTGGAGCTCGA
GGATAGTGTGATAGCGTGGCAGGATAAGTACGATCGGCTCTACGAATCGC
ACAAGCGGGTTCAAAAGGTCAATCAGAGCCTGGAGGACAAGATGCTCAAG
CTGGTGGATCGAAATGCCGGCGAAAGGGCACAGTTGACCAGCGATGTGGC
CACTTTGAGTGTGCGACTCGCCCAGGCAAACTTCAACATCGCCAAGCTGC
AGAGGGAAATCGAACGCTACAAGGCCGACATTAGCCTGGCCATCCAATTG
CTGCAGTGCAAGCCGGATAGTTTTGTGTCCCAGAAAGTGTCATCGCTACC
CATTGATATTCAGTCGAAGGTGTCGGCGTACATGAGACTGGAGACGAACT
CCCACTCCGATTCCGAGTGCAGCAATAGTGGAGTTGGCGTGGCCACCACA
GCTTCCTACAAAGTGCTTCCGGCCTCCGATTCGCCGCCCCCATCCGCCTG
CCCCTTCCCGCCCACGGCCATGGTGTATTCGATGAGGGGAATCGGTAGGT
GTTAGTAGACCATGTTGAGCCTTATGATTTTTTTTCTCATTTCCGCCTGA
TTTCGAATTTTTGATTTATTGATTTACGTTTTCTAGGCAACGGATTCAAT
CACGAAGACTGCGTTAAGTTAACAATATGATTTCGTTCCCTTGACTGCAT
TTAACAATCATTTTTTGCACTTTCAGCCATCACATATTTTATTTATTGTT
CATTGTATTCATTTTATTTGCTACAAAAAAAAAAAAA

IP06822.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42324-RC 1103 CG42324-RC 121..1103 1..983 4915 100 Plus
CG42324.b 1192 CG42324.b 235..1192 26..983 4790 100 Plus
CG42324.a 967 CG42324.a 77..821 1..745 3725 100 Plus
CG42324.a 967 CG42324.a 820..967 836..983 740 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3485259..3485695 26..462 2140 99.3 Plus
chr3L 24539361 chr3L 3504289..3504718 545..974 2120 99.5 Plus
chr3L 24539361 chr3L 3504122..3504205 462..545 420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3504887..3505325 545..983 2195 100 Plus
3L 28110227 3L 3485843..3486279 26..462 2185 100 Plus
3L 28110227 3L 3504720..3504803 462..545 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3504887..3505325 545..983 2195 100 Plus
3L 28103327 3L 3485843..3486279 26..462 2185 100 Plus
3L 28103327 3L 3504720..3504803 462..545 420 100 Plus
Blast to na_te.dros performed 2019-03-16 09:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2406..2531 46..170 168 60.3 Plus

IP06822.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:05:19 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3485134..3485159 1..26 100 -> Plus
chr3L 3485260..3485694 27..461 99 -> Plus
chr3L 3504122..3504205 462..545 100 -> Plus
chr3L 3504290..3504718 546..974 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:14:24 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RC 77..831 1..755 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:25:41 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RC 77..831 1..755 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:56:28 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RF 14..750 19..755 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:45:14 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RC 77..831 1..755 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:46 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RF 14..750 19..755 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:14:24 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RC 77..1050 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:25:41 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RC 77..1050 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:56:28 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RH 9..982 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:45:14 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RC 77..1050 1..974 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:46 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
CG42324-RH 9..982 1..974 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:19 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3485718..3485743 1..26 100 -> Plus
3L 3485844..3486278 27..461 100 -> Plus
3L 3504720..3504803 462..545 100 -> Plus
3L 3504888..3505316 546..974 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:19 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3485718..3485743 1..26 100 -> Plus
3L 3485844..3486278 27..461 100 -> Plus
3L 3504720..3504803 462..545 100 -> Plus
3L 3504888..3505316 546..974 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:05:19 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3485718..3485743 1..26 100 -> Plus
3L 3485844..3486278 27..461 100 -> Plus
3L 3504720..3504803 462..545 100 -> Plus
3L 3504888..3505316 546..974 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:56:28 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3485718..3485743 1..26 100 -> Plus
arm_3L 3485844..3486278 27..461 100 -> Plus
arm_3L 3504720..3504803 462..545 100 -> Plus
arm_3L 3504888..3505316 546..974 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:52:46 Download gff for IP06822.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3485718..3485743 1..26 100 -> Plus
3L 3485844..3486278 27..461 100 -> Plus
3L 3504720..3504803 462..545 100 -> Plus
3L 3504888..3505316 546..974 100   Plus

IP06822.pep Sequence

Translation from 2 to 754

> IP06822.pep
KPCDTLRPAATAGNPKAAEISTAKSAISTATAAPAIAATPLATSAPAAAE
IEQLQQALIEKQTQLYALESACLRETERQVELEDSVIAWQDKYDRLYESH
KRVQKVNQSLEDKMLKLVDRNAGERAQLTSDVATLSVRLAQANFNIAKLQ
REIERYKADISLAIQLLQCKPDSFVSQKVSSLPIDIQSKVSAYMRLETNS
HSDSECSNSGVGVATTASYKVLPASDSPPPSACPFPPTAMVYSMRGIGRC
*

IP06822.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24213-PA 944 GF24213-PA 27..120 154..247 421 100 Plus
Dana\GF20071-PA 83 GF20071-PA 1..40 114..153 193 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15146-PA 1037 GG15146-PA 8..246 9..247 1215 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16416-PA 198 GH16416-PA 62..165 50..153 519 92.3 Plus
Dgri\GH16417-PA 923 GH16417-PA 1..94 154..247 411 93.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42324-PF 249 CG42324-PF 8..249 9..250 1198 100 Plus
CG42324-PK 1037 CG42324-PK 8..248 9..249 1189 100 Plus
CG42324-PJ 1035 CG42324-PJ 8..246 9..247 1178 100 Plus
CG42324-PH 137 CG42324-PH 1..137 114..250 688 100 Plus
CG42324-PG 925 CG42324-PG 1..136 114..249 679 100 Plus
CG42324-PI 923 CG42324-PI 1..134 114..247 668 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12497-PA 637 GI12497-PA 1..135 114..248 608 94.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13252-PA 477 GL13252-PA 6..101 152..247 407 94.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:29:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28606-PA 1074 GA28606-PA 51..251 47..247 945 96.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14578-PA 185 GM14578-PA 26..175 1..153 759 98 Plus
Dsec\GM14579-PA 910 GM14579-PA 44..137 154..247 506 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13770-PA 194 GD13770-PA 27..176 1..153 755 98 Plus
Dsim\GD13772-PA 910 GD13772-PA 28..121 154..247 506 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12401-PA 158 GJ12401-PA 50..153 50..153 527 95.2 Plus
Dvir\GJ12402-PA 947 GJ12402-PA 4..97 154..247 410 94.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20517-PA 584 GK20517-PA 16..82 182..248 265 94 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21369-PA 1064 GE21369-PA 24..267 1..247 1048 91.5 Plus

IP06822.hyp Sequence

Translation from 2 to 754

> IP06822.hyp
KPCDTLRPAATAGNPKAAEISTAKSAISTATAAPAIAATPLATSAPAAAE
IEQLQQALIEKQTQLYALESACLRETERQVELEDSVIAWQDKYDRLYESH
KRVQKVNQSLEDKMLKLVDRNAGERAQLTSDVATLSVRLAQANFNIAKLQ
REIERYKADISLAIQLLQCKPDSFVSQKVSSLPIDIQSKVSAYMRLETNS
HSDSECSNSGVGVATTASYKVLPASDSPPPSACPFPPTAMVYSMRGIGRC
*

IP06822.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42324-PF 249 CG42324-PF 8..249 9..250 1198 100 Plus
CG42324-PK 1037 CG42324-PK 8..248 9..249 1189 100 Plus
CG42324-PJ 1035 CG42324-PJ 8..246 9..247 1178 100 Plus
CG42324-PH 137 CG42324-PH 1..137 114..250 688 100 Plus
CG42324-PG 925 CG42324-PG 1..136 114..249 679 100 Plus