Clone IP06843 Report

Search the DGRC for IP06843

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:68
Well:43
Vector:pOT2
Associated Gene/TranscriptCG15471-RB
Protein status:IP06843.pep: gold
Preliminary Size:561
Sequenced Size:539

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15471 2005-01-01 Successful iPCR screen
CG15471 2008-04-29 Release 5.5 accounting
CG15471 2008-08-15 Release 5.9 accounting
CG15471 2008-12-18 5.12 accounting

Clone Sequence Records

IP06843.complete Sequence

539 bp (539 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022601

> IP06843.complete
AAGAAATCAAACCGAAGCTATGGCCAGCCTGACGGAAGATCGGGGTCCCA
ATATCTGCAACTGTAGTCGAATGCGATCCGAGTGCTGGACAAGACATTCG
ATCACCGCCGAGGACACGATGACTCGTCTGGCTTTAAAGTACGACACGAG
CATTGGGCGCATATGCAGGGCCAATCGAATGCACAGCCAGGATGTCCTGC
AGGCACGCCGTCACGTTTGGGTGCCCATTCCAAACAGTCAGTTTCAGATG
GGGTGTCAAGAGAAATCAGAGTCCGACGAAAGTCCGGAGATCTCTATCAG
AAAAGTTACGCCGAACTTGCCGTCACATTTTTATCGCCAAAGCGATCCAA
ATCCAAATCCTTTTGCTTGCGATGACGATCCGCTGCTGGTCATCACAGAT
ATGTAGGAAGTTCTTCAATGAATTCCACGGCGCTGCACATCCACAACAAC
TGAAATAAATTGTTCGTTTGTAATTTGGTATATGTATTTCATAAAATTAT
TGTTTTCATACAAATAAGTTCTAAAAAAAAAAAAAAAAA

IP06843.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15471.a 584 CG15471.a 62..584 1..523 2615 100 Plus
CG15471-RB 547 CG15471-RB 25..547 1..523 2615 100 Plus
CG15471-RC 532 CG15471-RC 45..532 9..496 2440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4674953..4675466 522..9 2555 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4782200..4782714 523..9 2575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4790298..4790812 523..9 2575 100 Minus
Blast to na_te.dros performed 2019-03-16 18:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 294..339 515..470 113 71.7 Minus

IP06843.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:06:08 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4674953..4675466 9..522 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:48 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RC 1..387 20..406 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:59 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RC 1..387 20..406 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:39 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RB 1..387 20..406 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:49 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RC 1..387 20..406 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:29:29 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RB 1..387 20..406 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:10 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RB 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:58 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RB 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:39 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RB 14..535 1..522 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:49 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RB 1..522 1..522 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:29:29 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
CG15471-RB 14..535 1..522 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:08 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
X 4782201..4782714 9..522 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:08 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
X 4782201..4782714 9..522 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:06:08 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
X 4782201..4782714 9..522 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:39 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4676234..4676747 9..522 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:52 Download gff for IP06843.complete
Subject Subject Range Query Range Percent Splice Strand
X 4790299..4790812 9..522 100   Minus

IP06843.pep Sequence

Translation from 1 to 405

> IP06843.pep
RNQTEAMASLTEDRGPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTS
IGRICRANRMHSQDVLQARRHVWVPIPNSQFQMGCQEKSESDESPEISIR
KVTPNLPSHFYRQSDPNPNPFACDDDPLLVITDM*

IP06843.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20343-PA 179 GF20343-PA 15..167 16..134 272 41.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18515-PA 181 GG18515-PA 59..180 3..134 485 72 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12830-PA 136 GH12830-PA 3..131 11..134 275 43.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15471-PC 128 CG15471-PC 1..128 7..134 696 100 Plus
CG15471-PB 128 CG15471-PB 1..128 7..134 696 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14914-PA 216 GI14914-PA 4..126 13..130 223 39.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13098-PA 155 GL13098-PA 15..149 2..133 276 42.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13752-PA 155 GA13752-PA 15..149 2..133 283 45.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12664-PA 191 GM12664-PA 53..186 1..134 618 85.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16273-PA 191 GD16273-PA 53..186 1..134 620 85.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18947-PA 133 GJ18947-PA 3..130 6..132 269 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16832-PA 129 GE16832-PA 1..128 7..134 487 70.3 Plus

IP06843.hyp Sequence

Translation from 10 to 405

> IP06843.hyp
TEAMASLTEDRGPNICNCSRMRSECWTRHSITAEDTMTRLALKYDTSIGR
ICRANRMHSQDVLQARRHVWVPIPNSQFQMGCQEKSESDESPEISIRKVT
PNLPSHFYRQSDPNPNPFACDDDPLLVITDM*

IP06843.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG15471-PC 128 CG15471-PC 1..128 4..131 696 100 Plus
CG15471-PB 128 CG15471-PB 1..128 4..131 696 100 Plus