Clone IP06877 Report

Search the DGRC for IP06877

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:68
Well:77
Vector:pOT2
Associated Gene/TranscriptCG30050-RB
Protein status:IP06877.pep: gold
Preliminary Size:522
Sequenced Size:689

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30050 2005-01-01 Successful iPCR screen
CG30050 2008-04-29 Stopped prior to 5.5

Clone Sequence Records

IP06877.complete Sequence

689 bp assembled on 2011-04-22

GenBank Submission: BT126351.1

> IP06877.complete
AGACACGGGAATGTTGCCAATAATCTGGTGGTTCGGCATTATAGTATGCA
GTCTAGATACCGCAGATACCGCTAAGCTGATTCCAAACATGGGCTACTAT
ATAGAAATGAAGCAAATGGATTGCGTGGGCAATCCCAACTATTTCGCGAA
CCTGTACTGCAGGATTATACCACCCAAAAACCGGACCATGGAGGCTTCTG
TGAATATTATGCAACAGTTGAGTGTTTTCAGTGGTTCACTTCGAGTGTCC
ATACCCAATGCCAAGAAGGTCATAACCCAGATATTCGACATCACCTTCGA
TGTGTGCAAGGTGCTGCGGGAACGCAAGCGGAAGATTCTCATCGATCTTT
TGGTCAACACTTTGGCCAAGAACAGCAATGCAAAGGCTTGGAGATGTCCT
TTTCCAAAGGGTAAATTTGAGTCGAGAAACATTTCGGTTACCGATCTGCC
GCCAATGCTAACCGAATCGGAGTTTTTTGTGAACTTGGACTTCTTTATAC
CCAAGGTGGCCATTGCCATGAATGTCACCTTACATGGGCATCTCTTTGAG
ATTGCAAAGGAAAGGAACAGGCGGAAGAAATATTTGTAACTTCTAATGTA
CACGTAATTTAAATAAATGTATATAATTCAAAGCGAAGAGACAAACTTAA
AATGTATGGAATTGGAATTTAAAAAAAAAAAAAAAAAAA

IP06877.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8296343..8296667 86..410 1625 100 Plus
chr2R 21145070 chr2R 8296715..8296977 408..670 1315 100 Plus
chr2R 21145070 chr2R 8296192..8296276 1..85 425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12409101..12409425 86..410 1625 100 Plus
2R 25286936 2R 12409473..12409735 408..670 1315 100 Plus
2R 25286936 2R 12408954..12409038 1..85 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12410300..12410624 86..410 1625 100 Plus
2R 25260384 2R 12410672..12410934 408..670 1315 100 Plus
2R 25260384 2R 12410153..12410237 1..85 425 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:19:39 has no hits.

IP06877.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:20:45 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8296192..8296276 1..85 100 -> Plus
chr2R 8296343..8296666 86..409 100 -> Plus
chr2R 8296717..8296977 410..670 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-22 12:25:01 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
CG30050-RB 1..579 11..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:05:52 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
CG30050-RB 1..579 11..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:37:18 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
CG30050-RB 1..579 11..589 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-22 12:25:01 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
CG30050-RB 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:05:52 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
CG30050-RB 1..670 1..670 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:37:18 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
CG30050-RB 1..670 1..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:20:45 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12408954..12409038 1..85 100 -> Plus
2R 12409101..12409424 86..409 100 -> Plus
2R 12409475..12409735 410..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:20:45 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12408954..12409038 1..85 100 -> Plus
2R 12409101..12409424 86..409 100 -> Plus
2R 12409475..12409735 410..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:20:45 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12408954..12409038 1..85 100 -> Plus
2R 12409101..12409424 86..409 100 -> Plus
2R 12409475..12409735 410..670 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:05:52 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8296459..8296543 1..85 100 -> Plus
arm_2R 8296606..8296929 86..409 100 -> Plus
arm_2R 8296980..8297240 410..670 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:06:20 Download gff for IP06877.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12410300..12410623 86..409 100 -> Plus
2R 12410674..12410934 410..670 100   Plus
2R 12410153..12410237 1..85 100 -> Plus

IP06877.hyp Sequence

Translation from 0 to 588

> IP06877.hyp
DTGMLPIIWWFGIIVCSLDTADTAKLIPNMGYYIEMKQMDCVGNPNYFAN
LYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIFDITFD
VCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTDLP
PMLTESEFFVNLDFFIPKVAIAMNVTLHGHLFEIAKERNRRKKYL*

IP06877.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG30050-PB 192 CG30050-PB 1..192 4..195 1006 100 Plus
CG33627-PA 183 CG33627-PA 29..179 37..188 170 24.7 Plus
CG33626-PB 167 CG33626-PB 10..167 32..183 169 26.2 Plus

IP06877.pep Sequence

Translation from 1 to 588

> IP06877.pep
DTGMLPIIWWFGIIVCSLDTADTAKLIPNMGYYIEMKQMDCVGNPNYFAN
LYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIFDITFD
VCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTDLP
PMLTESEFFVNLDFFIPKVAIAMNVTLHGHLFEIAKERNRRKKYL*

IP06877.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12860-PA 196 GF12860-PA 6..196 10..195 656 64.9 Plus
Dana\GF12861-PA 188 GF12861-PA 1..186 4..192 182 22.5 Plus
Dana\GF19819-PA 139 GF19819-PA 1..138 46..183 145 27.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20296-PA 173 GG20296-PA 7..173 29..195 791 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20701-PA 294 GH20701-PA 1..104 30..134 214 40.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG30050-PB 192 CG30050-PB 1..192 4..195 1006 100 Plus
CG33627-PA 183 CG33627-PA 29..179 37..188 170 24.7 Plus
CG33626-PB 167 CG33626-PB 10..167 32..183 169 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19061-PA 164 GI19061-PA 1..164 30..195 388 42.5 Plus
Dmoj\GI18304-PA 124 GI18304-PA 23..124 93..195 238 44.2 Plus
Dmoj\GI19062-PA 181 GI19062-PA 23..180 34..191 181 28.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11637-PA 193 GL11637-PA 1..193 4..195 621 59.8 Plus
Dper\GL11639-PA 181 GL11639-PA 26..181 34..190 170 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15607-PA 193 GA15607-PA 1..193 4..195 627 59.8 Plus
Dpse\GA24800-PA 203 GA24800-PA 48..203 34..190 177 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21383-PA 173 GM21383-PA 7..173 29..195 852 94.6 Plus
Dsec\GM21385-PA 180 GM21385-PA 29..179 37..188 179 24.7 Plus
Dsec\GM21384-PA 156 GM21384-PA 17..156 44..183 148 24.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10880-PA 173 GD10880-PA 7..173 29..195 853 94.6 Plus
Dsim\GD10882-PA 183 GD10882-PA 29..181 37..190 185 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20031-PA 166 GJ20031-PA 1..166 30..195 394 45.8 Plus
Dvir\GJ20330-PA 193 GJ20330-PA 11..190 11..190 157 27.2 Plus
Dvir\GJ20033-PA 134 GJ20033-PA 35..133 89..188 139 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22934-PA 166 GK22934-PA 1..166 30..195 506 56.3 Plus
Dwil\GK19409-PA 164 GK19409-PA 7..156 34..183 198 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12456-PA 166 GE12456-PA 1..166 30..195 811 89.8 Plus
Dyak\GE12459-PA 183 GE12459-PA 29..181 37..190 160 22.4 Plus
Dyak\GE12458-PA 153 GE12458-PA 17..153 44..183 138 24.6 Plus