BDGP Sequence Production Resources |
Search the DGRC for IP06877
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 68 |
Well: | 77 |
Vector: | pOT2 |
Associated Gene/Transcript | CG30050-RB |
Protein status: | IP06877.pep: gold |
Preliminary Size: | 522 |
Sequenced Size: | 689 |
Gene | Date | Evidence |
---|---|---|
CG30050 | 2005-01-01 | Successful iPCR screen |
CG30050 | 2008-04-29 | Stopped prior to 5.5 |
689 bp assembled on 2011-04-22
GenBank Submission: BT126351.1
> IP06877.complete AGACACGGGAATGTTGCCAATAATCTGGTGGTTCGGCATTATAGTATGCA GTCTAGATACCGCAGATACCGCTAAGCTGATTCCAAACATGGGCTACTAT ATAGAAATGAAGCAAATGGATTGCGTGGGCAATCCCAACTATTTCGCGAA CCTGTACTGCAGGATTATACCACCCAAAAACCGGACCATGGAGGCTTCTG TGAATATTATGCAACAGTTGAGTGTTTTCAGTGGTTCACTTCGAGTGTCC ATACCCAATGCCAAGAAGGTCATAACCCAGATATTCGACATCACCTTCGA TGTGTGCAAGGTGCTGCGGGAACGCAAGCGGAAGATTCTCATCGATCTTT TGGTCAACACTTTGGCCAAGAACAGCAATGCAAAGGCTTGGAGATGTCCT TTTCCAAAGGGTAAATTTGAGTCGAGAAACATTTCGGTTACCGATCTGCC GCCAATGCTAACCGAATCGGAGTTTTTTGTGAACTTGGACTTCTTTATAC CCAAGGTGGCCATTGCCATGAATGTCACCTTACATGGGCATCTCTTTGAG ATTGCAAAGGAAAGGAACAGGCGGAAGAAATATTTGTAACTTCTAATGTA CACGTAATTTAAATAAATGTATATAATTCAAAGCGAAGAGACAAACTTAA AATGTATGGAATTGGAATTTAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 8296343..8296667 | 86..410 | 1625 | 100 | Plus |
chr2R | 21145070 | chr2R | 8296715..8296977 | 408..670 | 1315 | 100 | Plus |
chr2R | 21145070 | chr2R | 8296192..8296276 | 1..85 | 425 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 12410300..12410624 | 86..410 | 1625 | 100 | Plus |
2R | 25260384 | 2R | 12410672..12410934 | 408..670 | 1315 | 100 | Plus |
2R | 25260384 | 2R | 12410153..12410237 | 1..85 | 425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8296192..8296276 | 1..85 | 100 | -> | Plus |
chr2R | 8296343..8296666 | 86..409 | 100 | -> | Plus |
chr2R | 8296717..8296977 | 410..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30050-RB | 1..579 | 11..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30050-RB | 1..579 | 11..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30050-RB | 1..579 | 11..589 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30050-RB | 1..648 | 1..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30050-RB | 1..670 | 1..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30050-RB | 1..670 | 1..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12408954..12409038 | 1..85 | 100 | -> | Plus |
2R | 12409101..12409424 | 86..409 | 100 | -> | Plus |
2R | 12409475..12409735 | 410..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12408954..12409038 | 1..85 | 100 | -> | Plus |
2R | 12409101..12409424 | 86..409 | 100 | -> | Plus |
2R | 12409475..12409735 | 410..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12408954..12409038 | 1..85 | 100 | -> | Plus |
2R | 12409101..12409424 | 86..409 | 100 | -> | Plus |
2R | 12409475..12409735 | 410..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8296459..8296543 | 1..85 | 100 | -> | Plus |
arm_2R | 8296606..8296929 | 86..409 | 100 | -> | Plus |
arm_2R | 8296980..8297240 | 410..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12410300..12410623 | 86..409 | 100 | -> | Plus |
2R | 12410674..12410934 | 410..670 | 100 | Plus | |
2R | 12410153..12410237 | 1..85 | 100 | -> | Plus |
Translation from 0 to 588
> IP06877.hyp DTGMLPIIWWFGIIVCSLDTADTAKLIPNMGYYIEMKQMDCVGNPNYFAN LYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIFDITFD VCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTDLP PMLTESEFFVNLDFFIPKVAIAMNVTLHGHLFEIAKERNRRKKYL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30050-PB | 192 | CG30050-PB | 1..192 | 4..195 | 1006 | 100 | Plus |
CG33627-PA | 183 | CG33627-PA | 29..179 | 37..188 | 170 | 24.7 | Plus |
CG33626-PB | 167 | CG33626-PB | 10..167 | 32..183 | 169 | 26.2 | Plus |
Translation from 1 to 588
> IP06877.pep DTGMLPIIWWFGIIVCSLDTADTAKLIPNMGYYIEMKQMDCVGNPNYFAN LYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIFDITFD VCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESRNISVTDLP PMLTESEFFVNLDFFIPKVAIAMNVTLHGHLFEIAKERNRRKKYL*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12860-PA | 196 | GF12860-PA | 6..196 | 10..195 | 656 | 64.9 | Plus |
Dana\GF12861-PA | 188 | GF12861-PA | 1..186 | 4..192 | 182 | 22.5 | Plus |
Dana\GF19819-PA | 139 | GF19819-PA | 1..138 | 46..183 | 145 | 27.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20296-PA | 173 | GG20296-PA | 7..173 | 29..195 | 791 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20701-PA | 294 | GH20701-PA | 1..104 | 30..134 | 214 | 40.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30050-PB | 192 | CG30050-PB | 1..192 | 4..195 | 1006 | 100 | Plus |
CG33627-PA | 183 | CG33627-PA | 29..179 | 37..188 | 170 | 24.7 | Plus |
CG33626-PB | 167 | CG33626-PB | 10..167 | 32..183 | 169 | 26.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19061-PA | 164 | GI19061-PA | 1..164 | 30..195 | 388 | 42.5 | Plus |
Dmoj\GI18304-PA | 124 | GI18304-PA | 23..124 | 93..195 | 238 | 44.2 | Plus |
Dmoj\GI19062-PA | 181 | GI19062-PA | 23..180 | 34..191 | 181 | 28.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11637-PA | 193 | GL11637-PA | 1..193 | 4..195 | 621 | 59.8 | Plus |
Dper\GL11639-PA | 181 | GL11639-PA | 26..181 | 34..190 | 170 | 27 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15607-PA | 193 | GA15607-PA | 1..193 | 4..195 | 627 | 59.8 | Plus |
Dpse\GA24800-PA | 203 | GA24800-PA | 48..203 | 34..190 | 177 | 27.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21383-PA | 173 | GM21383-PA | 7..173 | 29..195 | 852 | 94.6 | Plus |
Dsec\GM21385-PA | 180 | GM21385-PA | 29..179 | 37..188 | 179 | 24.7 | Plus |
Dsec\GM21384-PA | 156 | GM21384-PA | 17..156 | 44..183 | 148 | 24.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10880-PA | 173 | GD10880-PA | 7..173 | 29..195 | 853 | 94.6 | Plus |
Dsim\GD10882-PA | 183 | GD10882-PA | 29..181 | 37..190 | 185 | 25 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20031-PA | 166 | GJ20031-PA | 1..166 | 30..195 | 394 | 45.8 | Plus |
Dvir\GJ20330-PA | 193 | GJ20330-PA | 11..190 | 11..190 | 157 | 27.2 | Plus |
Dvir\GJ20033-PA | 134 | GJ20033-PA | 35..133 | 89..188 | 139 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22934-PA | 166 | GK22934-PA | 1..166 | 30..195 | 506 | 56.3 | Plus |
Dwil\GK19409-PA | 164 | GK19409-PA | 7..156 | 34..183 | 198 | 31.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12456-PA | 166 | GE12456-PA | 1..166 | 30..195 | 811 | 89.8 | Plus |
Dyak\GE12459-PA | 183 | GE12459-PA | 29..181 | 37..190 | 160 | 22.4 | Plus |
Dyak\GE12458-PA | 153 | GE12458-PA | 17..153 | 44..183 | 138 | 24.6 | Plus |