BDGP Sequence Production Resources |
Search the DGRC for IP06878
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 68 |
Well: | 78 |
Vector: | pOT2 |
Associated Gene/Transcript | CG30051-RC |
Protein status: | IP06878.pep: gold |
Preliminary Size: | 570 |
Sequenced Size: | 647 |
Gene | Date | Evidence |
---|---|---|
CG30051 | 2005-01-01 | Successful iPCR screen |
CG30051 | 2008-04-29 | Release 5.5 accounting |
CG30051 | 2008-08-15 | Release 5.9 accounting |
CG30051 | 2008-12-18 | 5.12 accounting |
647 bp (647 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022606
> IP06878.complete AAACATTTATATTCACAAAAATCTGTACGATGCACCCAGGGCAAATTGAG GTCAACGAGATCAATGGCTATTGGACATTTCTGCTGAGCATCGATTGGAA GGATCCCTGGCTTATTGGCCTTATTTTGGCGCATATCTTAACCACCACCA CTGCGCTGCTCAGCCGGAACAGCTCCAACTTCCAGGTTTTCCTCTTCCTA GTACTGTTGCTGGCAGTCTACTTCACCGAAAGCATCAATGAGTTCGCTGC TAACAACTGGAGTTCCTTTTCCAGACAACAATACTTCGATAGCAACGGCC TGTTTATCTCGACAGTTTTCTCAATACCTATTTTGCTTAATTGCATGCTT TTGATTGGCACTTGGCTCTACAACTCCACGCAGCTGATGGTGACTCTAAA AACAGCGCAGCTCAAGGAGCGAGCTCGCAAGGAACGCCAGACTAAGGCGG ATTCGGAATCCATAGCACATAAAAAGGCAGAGTAGAACTTACGCCTGTAT TACATGCAGTTAAAAGCACAAGTAGAGCTGTGAAATTATATGTTATGCTT TAAATGGATTTTCCTGTCATCTAGATGTAGTTTGCTGCACAGCTCTCGTC TTTAAAATAAATTTAATTTAGTATAATCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 8323962..8324233 | 357..628 | 1345 | 99.6 | Plus |
chr2R | 21145070 | chr2R | 8323757..8323906 | 208..357 | 750 | 100 | Plus |
chr2R | 21145070 | chr2R | 8323564..8323681 | 90..207 | 560 | 98.3 | Plus |
chr2R | 21145070 | chr2R | 8323411..8323499 | 1..89 | 445 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 12436719..12436993 | 357..631 | 1375 | 100 | Plus |
2R | 25286936 | 2R | 12436514..12436663 | 208..357 | 750 | 100 | Plus |
2R | 25286936 | 2R | 12436321..12436438 | 90..207 | 590 | 100 | Plus |
2R | 25286936 | 2R | 12436168..12436256 | 1..89 | 445 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 12437918..12438192 | 357..631 | 1375 | 100 | Plus |
2R | 25260384 | 2R | 12437713..12437862 | 208..357 | 750 | 100 | Plus |
2R | 25260384 | 2R | 12437520..12437637 | 90..207 | 590 | 100 | Plus |
2R | 25260384 | 2R | 12437367..12437455 | 1..89 | 445 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8323962..8324233 | 357..628 | 99 | Plus | |
chr2R | 8323411..8323499 | 1..89 | 100 | -> | Plus |
chr2R | 8323564..8323681 | 90..207 | 98 | -> | Plus |
chr2R | 8323757..8323905 | 208..356 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 1..456 | 30..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 1..456 | 30..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 1..456 | 30..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 1..456 | 30..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 1..456 | 30..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 72..699 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 72..699 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 49..676 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 72..699 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30051-RC | 49..676 | 1..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12436168..12436256 | 1..89 | 100 | -> | Plus |
2R | 12436321..12436438 | 90..207 | 100 | -> | Plus |
2R | 12436514..12436662 | 208..356 | 100 | -> | Plus |
2R | 12436719..12436990 | 357..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12436168..12436256 | 1..89 | 100 | -> | Plus |
2R | 12436321..12436438 | 90..207 | 100 | -> | Plus |
2R | 12436514..12436662 | 208..356 | 100 | -> | Plus |
2R | 12436719..12436990 | 357..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12436168..12436256 | 1..89 | 100 | -> | Plus |
2R | 12436321..12436438 | 90..207 | 100 | -> | Plus |
2R | 12436514..12436662 | 208..356 | 100 | -> | Plus |
2R | 12436719..12436990 | 357..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8323673..8323761 | 1..89 | 100 | -> | Plus |
arm_2R | 8323826..8323943 | 90..207 | 100 | -> | Plus |
arm_2R | 8324019..8324167 | 208..356 | 100 | -> | Plus |
arm_2R | 8324224..8324495 | 357..628 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12437918..12438189 | 357..628 | 100 | Plus | |
2R | 12437367..12437455 | 1..89 | 100 | -> | Plus |
2R | 12437520..12437637 | 90..207 | 100 | -> | Plus |
2R | 12437713..12437861 | 208..356 | 100 | -> | Plus |
Translation from 2 to 484
> IP06878.hyp TFIFTKICTMHPGQIEVNEINGYWTFLLSIDWKDPWLIGLILAHILTTTT ALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSRQQYFDSNGL FISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKAD SESIAHKKAE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30051-PC | 151 | CG30051-PC | 1..151 | 10..160 | 777 | 100 | Plus |
Translation from 2 to 484
> IP06878.pep TFIFTKICTMHPGQIEVNEINGYWTFLLSIDWKDPWLIGLILAHILTTTT ALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSRQQYFDSNGL FISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKAD SESIAHKKAE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12512-PA | 152 | GF12512-PA | 1..152 | 10..160 | 691 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20304-PA | 151 | GG20304-PA | 1..151 | 10..160 | 779 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21965-PA | 152 | GH21965-PA | 1..135 | 10..144 | 613 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tmem18-PC | 151 | CG30051-PC | 1..151 | 10..160 | 777 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19670-PA | 156 | GI19670-PA | 1..145 | 10..155 | 621 | 79.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17133-PA | 148 | GL17133-PA | 1..148 | 10..160 | 540 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15608-PA | 148 | GA15608-PA | 1..148 | 10..160 | 526 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21391-PA | 151 | GM21391-PA | 1..151 | 10..160 | 771 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10887-PA | 151 | GD10887-PA | 1..151 | 10..160 | 771 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15036-PA | 154 | GJ15036-PA | 1..144 | 10..153 | 623 | 79.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15828-PA | 158 | GK15828-PA | 1..136 | 10..145 | 603 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12464-PA | 151 | GE12464-PA | 1..151 | 10..160 | 770 | 96 | Plus |