Clone IP06878 Report

Search the DGRC for IP06878

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:68
Well:78
Vector:pOT2
Associated Gene/TranscriptCG30051-RC
Protein status:IP06878.pep: gold
Preliminary Size:570
Sequenced Size:647

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30051 2005-01-01 Successful iPCR screen
CG30051 2008-04-29 Release 5.5 accounting
CG30051 2008-08-15 Release 5.9 accounting
CG30051 2008-12-18 5.12 accounting

Clone Sequence Records

IP06878.complete Sequence

647 bp (647 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022606

> IP06878.complete
AAACATTTATATTCACAAAAATCTGTACGATGCACCCAGGGCAAATTGAG
GTCAACGAGATCAATGGCTATTGGACATTTCTGCTGAGCATCGATTGGAA
GGATCCCTGGCTTATTGGCCTTATTTTGGCGCATATCTTAACCACCACCA
CTGCGCTGCTCAGCCGGAACAGCTCCAACTTCCAGGTTTTCCTCTTCCTA
GTACTGTTGCTGGCAGTCTACTTCACCGAAAGCATCAATGAGTTCGCTGC
TAACAACTGGAGTTCCTTTTCCAGACAACAATACTTCGATAGCAACGGCC
TGTTTATCTCGACAGTTTTCTCAATACCTATTTTGCTTAATTGCATGCTT
TTGATTGGCACTTGGCTCTACAACTCCACGCAGCTGATGGTGACTCTAAA
AACAGCGCAGCTCAAGGAGCGAGCTCGCAAGGAACGCCAGACTAAGGCGG
ATTCGGAATCCATAGCACATAAAAAGGCAGAGTAGAACTTACGCCTGTAT
TACATGCAGTTAAAAGCACAAGTAGAGCTGTGAAATTATATGTTATGCTT
TAAATGGATTTTCCTGTCATCTAGATGTAGTTTGCTGCACAGCTCTCGTC
TTTAAAATAAATTTAATTTAGTATAATCAAAAAAAAAAAAAAAAAAA

IP06878.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051.a 702 CG30051.a 72..702 1..631 3155 100 Plus
CG30051-RC 702 CG30051-RC 72..702 1..631 3155 100 Plus
CG8830-RB 3569 CG8830-RB 1..64 271..208 320 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8323962..8324233 357..628 1345 99.6 Plus
chr2R 21145070 chr2R 8323757..8323906 208..357 750 100 Plus
chr2R 21145070 chr2R 8323564..8323681 90..207 560 98.3 Plus
chr2R 21145070 chr2R 8323411..8323499 1..89 445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12436719..12436993 357..631 1375 100 Plus
2R 25286936 2R 12436514..12436663 208..357 750 100 Plus
2R 25286936 2R 12436321..12436438 90..207 590 100 Plus
2R 25286936 2R 12436168..12436256 1..89 445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12437918..12438192 357..631 1375 100 Plus
2R 25260384 2R 12437713..12437862 208..357 750 100 Plus
2R 25260384 2R 12437520..12437637 90..207 590 100 Plus
2R 25260384 2R 12437367..12437455 1..89 445 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:24:39 has no hits.

IP06878.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:25:24 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8323962..8324233 357..628 99   Plus
chr2R 8323411..8323499 1..89 100 -> Plus
chr2R 8323564..8323681 90..207 98 -> Plus
chr2R 8323757..8323905 208..356 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:51 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 1..456 30..485 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:02 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 1..456 30..485 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:46 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 1..456 30..485 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:52 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 1..456 30..485 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:49 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 1..456 30..485 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:15 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 72..699 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:02 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 72..699 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:46 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 49..676 1..628 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:52 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 72..699 1..628 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:49 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 49..676 1..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:24 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12436168..12436256 1..89 100 -> Plus
2R 12436321..12436438 90..207 100 -> Plus
2R 12436514..12436662 208..356 100 -> Plus
2R 12436719..12436990 357..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:24 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12436168..12436256 1..89 100 -> Plus
2R 12436321..12436438 90..207 100 -> Plus
2R 12436514..12436662 208..356 100 -> Plus
2R 12436719..12436990 357..628 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:24 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12436168..12436256 1..89 100 -> Plus
2R 12436321..12436438 90..207 100 -> Plus
2R 12436514..12436662 208..356 100 -> Plus
2R 12436719..12436990 357..628 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:46 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8323673..8323761 1..89 100 -> Plus
arm_2R 8323826..8323943 90..207 100 -> Plus
arm_2R 8324019..8324167 208..356 100 -> Plus
arm_2R 8324224..8324495 357..628 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:56 Download gff for IP06878.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12437918..12438189 357..628 100   Plus
2R 12437367..12437455 1..89 100 -> Plus
2R 12437520..12437637 90..207 100 -> Plus
2R 12437713..12437861 208..356 100 -> Plus

IP06878.hyp Sequence

Translation from 2 to 484

> IP06878.hyp
TFIFTKICTMHPGQIEVNEINGYWTFLLSIDWKDPWLIGLILAHILTTTT
ALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSRQQYFDSNGL
FISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKAD
SESIAHKKAE*

IP06878.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051-PC 151 CG30051-PC 1..151 10..160 777 100 Plus

IP06878.pep Sequence

Translation from 2 to 484

> IP06878.pep
TFIFTKICTMHPGQIEVNEINGYWTFLLSIDWKDPWLIGLILAHILTTTT
ALLSRNSSNFQVFLFLVLLLAVYFTESINEFAANNWSSFSRQQYFDSNGL
FISTVFSIPILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKAD
SESIAHKKAE*

IP06878.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12512-PA 152 GF12512-PA 1..152 10..160 691 84.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20304-PA 151 GG20304-PA 1..151 10..160 779 98 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21965-PA 152 GH21965-PA 1..135 10..144 613 81.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Tmem18-PC 151 CG30051-PC 1..151 10..160 777 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19670-PA 156 GI19670-PA 1..145 10..155 621 79.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17133-PA 148 GL17133-PA 1..148 10..160 540 76.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15608-PA 148 GA15608-PA 1..148 10..160 526 76.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21391-PA 151 GM21391-PA 1..151 10..160 771 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10887-PA 151 GD10887-PA 1..151 10..160 771 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15036-PA 154 GJ15036-PA 1..144 10..153 623 79.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15828-PA 158 GK15828-PA 1..136 10..145 603 82.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12464-PA 151 GE12464-PA 1..151 10..160 770 96 Plus