Clone IP06881 Report

Search the DGRC for IP06881

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:68
Well:81
Vector:pOT2
Associated Gene/TranscriptCG30062-RB
Protein status:IP06881.pep: gold
Preliminary Size:622
Sequenced Size:630

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30062 2005-01-01 Successful iPCR screen
CG30062 2008-04-29 Release 5.5 accounting
CG30062 2008-08-15 Release 5.9 accounting
CG30062 2008-12-18 5.12 accounting

Clone Sequence Records

IP06881.complete Sequence

630 bp (630 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022609.1

> IP06881.complete
CTGGAGCCCGCTTGGAATGGTCCGATCAAGTTGGTCGAAAGTGAGAGTAC
TCCCGTTGCTGTGGTTCCTGTTCCACGGGATTCCCCTGCTGGCCATTCGC
TTGCAGCCCTGCGAATTAGCTGGCCAACTCTACATACTGGATGTCCCGAA
ATCGGAATTACCCCTATGGCTTTGTATTGCCGAATTCGAGAGCCGATTCA
ACACGCACGTTGTGGGCCAGGCCAATGCGGATGGATCCCGGGATTACGGA
CTGTTCCAAATCAGCGATCGCTACTGGTGTGCGCCGCCAAATCGAACGGA
ATACTATGCATTCAACGATTGCAATGTGAATTGCACTCACCTTCTGAGCG
ACGACATCACCATGGCCGTCCAGTGCGCCCGGCTCATTCAGAAGCAACAG
GGCTGGACGGCCTGGTCCGTTTATCCGGAGTTCTGCAATGGCACATTGGA
TGCCATCGATGTGTGTTTCCAGCCAGGAAACGCCACAGAATCCATGACCA
GCGACGAGCTGGCAGAGGTCAAAGATTGTTAGAGATAGTCTGCCCATTAG
GTCATCACTGCCGAAATATGAGAATTTATGTATGCGAAATTAAAATCTTA
ATTACCGTTTAAAAAAAAAAAAAAAAAAAA

IP06881.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30062-RA 639 CG30062-RA 30..639 1..610 3050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9333029..9333638 610..1 2975 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13445697..13446309 613..1 3065 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13446896..13447508 613..1 3065 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:47:53 has no hits.

IP06881.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:48:45 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9333029..9333638 1..610 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:52 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RA 30..561 1..532 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:09:03 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RB 1..516 17..532 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:58:21 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RB 1..516 17..532 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:53 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RA 30..561 1..532 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:02:54 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RB 1..516 17..532 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:00:17 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RA 30..622 1..593 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:09:03 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RB 1..610 1..610 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:58:21 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RB 1..610 1..610 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:54 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RA 30..622 1..593 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:02:54 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
CG30062-RB 1..610 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:45 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13445700..13446309 1..610 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:45 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13445700..13446309 1..610 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:45 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13445700..13446309 1..610 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:58:21 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9333205..9333814 1..610 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:58 Download gff for IP06881.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13446899..13447508 1..610 100   Minus

IP06881.hyp Sequence

Translation from 0 to 609

> IP06881.hyp
LEPAWNGPIKLVESESTPVAVVPVPRDSPAGHSLAALRISWPTLHTGCPE
IGITPMALYCRIREPIQHARCGPGQCGWIPGLRTVPNQRSLLVCAAKSNG
ILCIQRLQCELHSPSERRHHHGRPVRPAHSEATGLDGLVRLSGVLQWHIG
CHRCVFPARKRHRIHDQRRAGRGQRLLEIVCPLGHHCRNMRIYVCEIKIL
ITV
Sequence IP06881.hyp has no blast hits.

IP06881.pep Sequence

Translation from 16 to 531

> IP06881.pep
MVRSSWSKVRVLPLLWFLFHGIPLLAIRLQPCELAGQLYILDVPKSELPL
WLCIAEFESRFNTHVVGQANADGSRDYGLFQISDRYWCAPPNRTEYYAFN
DCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYPEFCNGTLDAIDVC
FQPGNATESMTSDELAEVKDC*

IP06881.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10073-PA 140 GF10073-PA 21..140 29..151 338 48.8 Plus
Dana\GF10076-PA 142 GF10076-PA 17..142 24..152 336 49.6 Plus
Dana\GF10070-PA 141 GF10070-PA 9..141 11..151 324 43.3 Plus
Dana\GF24437-PA 140 GF24437-PA 22..140 29..151 324 50.4 Plus
Dana\GF24435-PA 111 GF24435-PA 1..111 38..151 318 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14615-PA 141 GG14615-PA 5..141 12..151 339 44.3 Plus
Dere\GG14617-PA 140 GG14617-PA 21..140 29..151 326 49.6 Plus
Dere\GG19822-PA 140 GG19822-PA 21..140 29..151 326 49.6 Plus
Dere\GG14762-PA 140 GG14762-PA 21..140 29..151 326 49.6 Plus
Dere\GG14759-PA 140 GG14759-PA 21..140 29..151 326 49.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15987-PA 140 GH15987-PA 21..140 29..151 329 49.6 Plus
Dgri\GH15989-PA 140 GH15989-PA 21..140 29..151 329 49.6 Plus
Dgri\GH15486-PA 140 GH15486-PA 21..140 29..151 328 49.6 Plus
Dgri\GH15485-PA 140 GH15485-PA 21..140 29..151 328 49.6 Plus
Dgri\GH15988-PA 143 GH15988-PA 19..143 23..151 323 49.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG30062-PB 171 CG30062-PB 1..171 1..171 939 100 Plus
LysP-PA 141 CG9116-PA 25..141 32..151 348 50.8 Plus
LysB-PB 140 CG1179-PB 15..140 23..151 342 48.1 Plus
LysB-PA 140 CG1179-PA 15..140 23..151 342 48.1 Plus
LysE-PA 140 CG1180-PA 15..140 23..151 339 48.1 Plus
LysD-PA 140 CG9118-PA 15..140 23..151 338 47.3 Plus
LysS-PA 140 CG1165-PA 15..140 23..151 337 49.2 Plus
LysX-PA 142 CG9120-PA 17..141 24..151 307 45.3 Plus
CG7798-PA 148 CG7798-PA 23..141 32..152 290 46.7 Plus
CG8492-PD 1360 CG8492-PD 601..740 32..167 265 41.7 Plus
CG8492-PD 1360 CG8492-PD 444..555 32..140 254 46.6 Plus
CG8492-PD 1360 CG8492-PD 190..313 32..151 248 43 Plus
CG8492-PD 1360 CG8492-PD 11..156 22..162 201 33.8 Plus
CG11159-PA 146 CG11159-PA 30..146 29..150 167 35 Plus
CG16799-PB 179 CG16799-PB 24..149 11..140 167 32.1 Plus
CG16799-PA 179 CG16799-PA 24..149 11..140 167 32.1 Plus
CG16756-PA 152 CG16756-PA 29..137 26..140 159 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16641-PA 144 GI16641-PA 6..144 11..152 359 49.3 Plus
Dmoj\GI16642-PA 140 GI16642-PA 21..140 29..151 329 50.4 Plus
Dmoj\GI16637-PA 140 GI16637-PA 21..140 29..151 321 48.8 Plus
Dmoj\GI16638-PA 140 GI16638-PA 21..140 29..151 321 48.8 Plus
Dmoj\GI16762-PA 140 GI16762-PA 21..140 29..151 315 48.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16156-PA 140 GL16156-PA 21..140 29..151 326 48 Plus
Dper\GL16691-PA 140 GL16691-PA 21..140 29..151 326 48 Plus
Dper\GL16082-PA 146 GL16082-PA 19..143 24..151 321 47.7 Plus
Dper\GL21426-PA 142 GL21426-PA 21..136 29..147 315 47.9 Plus
Dper\GL16157-PA 120 GL16157-PA 1..120 29..151 314 48 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15617-PB 194 GA15617-PB 51..174 30..153 611 87.1 Plus
Dpse\GA28479-PA 144 GA28479-PA 22..144 26..151 329 47.6 Plus
Dpse\GA28484-PA 140 GA28484-PA 21..140 29..151 326 48 Plus
Dpse\GA28404-PA 140 GA28404-PA 21..140 29..151 326 48 Plus
Dpse\GA28406-PA 140 GA28406-PA 21..140 29..151 324 48.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14378-PA 140 GM14378-PA 21..140 29..151 324 49.6 Plus
Dsec\GM14382-PA 140 GM14382-PA 21..140 29..151 322 48.8 Plus
Dsec\GM14380-PA 140 GM14380-PA 21..140 29..151 321 48.8 Plus
Dsec\GM14229-PA 140 GM14229-PA 21..140 29..151 321 48.8 Plus
Dsec\GM20080-PA 148 GM20080-PA 23..141 32..152 255 45.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13593-PA 140 GD13593-PA 21..140 29..151 324 49.6 Plus
Dsim\GD13594-PA 140 GD13594-PA 21..140 29..151 322 48.8 Plus
Dsim\GD17618-PA 140 GD17618-PA 4..140 19..151 318 46.1 Plus
Dsim\GD17617-PA 140 GD17617-PA 4..140 19..151 318 46.1 Plus
Dsim\GD13493-PA 160 GD13493-PA 17..159 24..169 313 43.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12894-PA 143 GJ12894-PA 5..143 11..152 342 46.5 Plus
Dvir\GJ12893-PA 140 GJ12893-PA 1..140 9..151 335 44.8 Plus
Dvir\GJ12896-PA 120 GJ12896-PA 1..120 29..151 328 50.4 Plus
Dvir\GJ12895-PA 140 GJ12895-PA 1..140 9..151 328 43.4 Plus
Dvir\GJ12508-PA 140 GJ12508-PA 1..140 9..151 326 44.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21106-PA 141 GK21106-PA 15..141 22..151 338 49.2 Plus
Dwil\GK21095-PA 141 GK21095-PA 15..141 22..151 338 49.2 Plus
Dwil\GK21117-PA 142 GK21117-PA 23..142 29..151 329 52 Plus
Dwil\GK12154-PA 141 GK12154-PA 22..141 29..151 328 50.4 Plus
Dwil\GK21084-PA 141 GK21084-PA 22..141 29..151 328 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20976-PA 141 GE20976-PA 4..141 11..151 336 43.3 Plus
Dyak\GE21123-PA 140 GE21123-PA 21..140 29..151 322 48.8 Plus
Dyak\GE21125-PA 140 GE21125-PA 21..140 29..151 319 48 Plus
Dyak\GE20981-PA 142 GE20981-PA 1..142 9..152 319 44.8 Plus
Dyak\LysS-PA 140 GE21126-PA 4..140 19..151 318 46.1 Plus