IP06931.complete Sequence
768 bp (768 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022618
> IP06931.complete
CAGAATAGAAAAGCTACTTGAAATCGTCCGGCCGGAACTCAAATGTAGAT
TTGAAAAACTATTCAAGTGTTAAGTGCTCTGCTGACCATGTTGAAGGACA
CCGCCACCGCATCGACCAGCGAACTTGCAGGGGAAGTGGGTGACGCCCAT
TCGACTCCTGGCAGCTGCCCTCCGCCCGCCGCGGGCGACACGCCCCCCGT
CGTTAGCCGACCGCTGGACCGACGCCTAAACCCCAACGCACCTGTGTTTG
TGCCCGACTTCAAGGCCAGCCAGGTGGCCAAAAAGCTATTTGATGAGTTA
TCTACGTACACCCGGTGGAGTACGGCAACCTCGGAGGACATATGCTACGA
GCCCCGTTACGAGTCCATCTGGCGTGAGGCCAGCATCCAGCAGCAGCAGG
GTCTGCGCCATCCGGGTTTCGTTTACAGCCTGGATCCTGGCGAGGAGGAG
GTTGGCGAACTGGAGTTTGACGAAGTCCAGGCCATGAATATCGGAGCCGA
GTCCTATGATCCCAAGCTAGGAAGCACATCAGTTAGCCAGGCAATGGAAG
TTCGCGAAACTGTGGGTGATGTGGAGGAACCTTTAGATGAGGAAAAAAGG
AATGGCTTTCAGAATCGCCACTCCGCCAGACCGGCCAAAAAGTGCTGTCT
GGTCATGTAGGTCCCACGGAATGGCAAATTTATATATTTATTTTCCATTT
GTTTTCACACCTACATGCAACTCAGTAAATTGCTTCCTTACTCTCTCAAA
AAAAAAAAAAAAAAAAAA
IP06931.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:45:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15136.a | 989 | CG15136.a | 240..988 | 1..749 | 3745 | 100 | Plus |
CG15136-RA | 743 | CG15136-RA | 1..742 | 8..749 | 3710 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:57:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 17045776..17046224 | 747..299 | 2245 | 100 | Minus |
chr2L | 23010047 | chr2L | 17046386..17046683 | 298..1 | 1490 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:57:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 17047159..17047609 | 749..299 | 2255 | 100 | Minus |
2L | 23513712 | 2L | 17047771..17048068 | 298..1 | 1490 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 17047159..17047609 | 749..299 | 2255 | 100 | Minus |
2L | 23513712 | 2L | 17047771..17048068 | 298..1 | 1490 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 17:57:45 has no hits.
IP06931.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:58:46 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 17045776..17046224 | 299..747 | 100 | <- | Minus |
chr2L | 17046386..17046683 | 1..298 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:57 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..573 | 88..660 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:54 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..573 | 88..660 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:51:14 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..573 | 88..660 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:18 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..573 | 88..660 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:51:16 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..573 | 88..660 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:23 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..573 | 88..660 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:54 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..747 | 1..747 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:51:14 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..747 | 1..747 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:18 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..573 | 88..660 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:51:16 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15136-RA | 1..747 | 1..747 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:58:46 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17047161..17047609 | 299..747 | 100 | <- | Minus |
2L | 17047771..17048068 | 1..298 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:58:46 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17047161..17047609 | 299..747 | 100 | <- | Minus |
2L | 17047771..17048068 | 1..298 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:58:46 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17047161..17047609 | 299..747 | 100 | <- | Minus |
2L | 17047771..17048068 | 1..298 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:51:14 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 17047161..17047609 | 299..747 | 100 | <- | Minus |
arm_2L | 17047771..17048068 | 1..298 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:53 Download gff for
IP06931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17047161..17047609 | 299..747 | 100 | <- | Minus |
2L | 17047771..17048068 | 1..298 | 100 | | Minus |
IP06931.hyp Sequence
Translation from 87 to 659
> IP06931.hyp
MLKDTATASTSELAGEVGDAHSTPGSCPPPAAGDTPPVVSRPLDRRLNPN
APVFVPDFKASQVAKKLFDELSTYTRWSTATSEDICYEPRYESIWREASI
QQQQGLRHPGFVYSLDPGEEEVGELEFDEVQAMNIGAESYDPKLGSTSVS
QAMEVRETVGDVEEPLDEEKRNGFQNRHSARPAKKCCLVM*
IP06931.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15136-PB | 190 | CG15136-PB | 1..190 | 1..190 | 1001 | 100 | Plus |
CG15136-PA | 190 | CG15136-PA | 1..190 | 1..190 | 1001 | 100 | Plus |
IP06931.pep Sequence
Translation from 87 to 659
> IP06931.pep
MLKDTATASTSELAGEVGDAHSTPGSCPPPAAGDTPPVVSRPLDRRLNPN
APVFVPDFKASQVAKKLFDELSTYTRWSTATSEDICYEPRYESIWREASI
QQQQGLRHPGFVYSLDPGEEEVGELEFDEVQAMNIGAESYDPKLGSTSVS
QAMEVRETVGDVEEPLDEEKRNGFQNRHSARPAKKCCLVM*
IP06931.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14782-PA | 210 | GF14782-PA | 41..204 | 19..187 | 292 | 43.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21758-PA | 198 | GG21758-PA | 1..198 | 1..190 | 699 | 76.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15136-PB | 190 | CG15136-PB | 1..190 | 1..190 | 1001 | 100 | Plus |
CG15136-PA | 190 | CG15136-PA | 1..190 | 1..190 | 1001 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI14248-PA | 182 | GI14248-PA | 36..108 | 37..103 | 171 | 43.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17142-PA | 190 | GM17142-PA | 1..190 | 1..190 | 858 | 90.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21883-PA | 190 | GD21883-PA | 1..190 | 1..190 | 875 | 91.1 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ16243-PA | 171 | GJ16243-PA | 37..166 | 37..187 | 201 | 34.2 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK23877-PA | 179 | GK23877-PA | 36..98 | 37..98 | 141 | 49.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13148-PA | 190 | GE13148-PA | 1..190 | 1..190 | 827 | 83.2 | Plus |