IP06935.complete Sequence
551 bp (551 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022621
> IP06935.complete
AGCACATCAAAAATAAATTTTCGGCAGCATTTTTTAAAAGTTTACAAATT
TCGAATTACCAAATTTCGAGATAAAATTCATCCACGATTTTTTTCGAAAT
AAAACATCCAGCCATGTCGAACGGTTTTTCCTTCTGGAACGGACAGCCAG
TGAATGCGCCTATCTTTCCCCAAATGGGTGATGCCATAAACGTTGGTAGC
CAGTGGTCGTCCAGCGTGGCACCAGGATCCTGTGGACCAAGAACTCGACC
GATGCTGCAGAGCATGGGCGATTTCCAGCCGATGAGATGTCCTCCAGTGC
CACCCAACTTCTTTGGCCAGCCGCACGCCATGGGAACTGGATTTGGAGAT
GATCAGGGACCCTGCGAACCCTGCATCGATAATGGAGAAGCCTTCTGCGC
CTACAACGGCTTGGATATGAGCTGTGCCGGGAGAATTAAGGGCGATTTCT
GGTAGTAAATCAGTTGTCCCATCCAAGACCTTCTTGTTCACAAAGTCGTT
GGAATAAATTTTGCATTGTGGTCTCTGCTAGCTCAAAAAAAAAAAAAAAA
A
IP06935.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:45:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15200-RA | 557 | CG15200-RA | 13..549 | 1..537 | 2685 | 100 | Plus |
CG1394-RA | 827 | CG1394-RA | 542..598 | 366..422 | 210 | 91.2 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:40:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 11074170..11074703 | 1..534 | 2580 | 98.9 | Plus |
chrX | 22417052 | chrX | 11061304..11061360 | 422..366 | 210 | 91.2 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:40:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 11182943..11183479 | 1..537 | 2685 | 100 | Plus |
X | 23542271 | X | 11170051..11170107 | 422..366 | 210 | 91.2 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 11191041..11191577 | 1..537 | 2685 | 100 | Plus |
X | 23527363 | X | 11178149..11178205 | 422..366 | 210 | 91.2 | Minus |
Blast to na_te.dros performed on 2019-03-16 09:40:24 has no hits.
IP06935.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:41:22 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 11074170..11074703 | 1..534 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:58 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 1..342 | 114..455 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:55 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 1..342 | 114..455 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:04 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 1..342 | 114..455 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:20 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 1..342 | 114..455 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:21 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 1..342 | 114..455 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:26 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 13..546 | 1..534 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:55 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 13..546 | 1..534 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:04 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 13..546 | 1..534 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:20 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 13..546 | 1..534 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:21 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15200-RA | 13..546 | 1..534 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:22 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11182943..11183476 | 1..534 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:22 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11182943..11183476 | 1..534 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:22 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11182943..11183476 | 1..534 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:04 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 11076976..11077509 | 1..534 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:54 Download gff for
IP06935.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 11191041..11191574 | 1..534 | 100 | | Plus |
IP06935.hyp Sequence
Translation from 113 to 454
> IP06935.hyp
MSNGFSFWNGQPVNAPIFPQMGDAINVGSQWSSSVAPGSCGPRTRPMLQS
MGDFQPMRCPPVPPNFFGQPHAMGTGFGDDQGPCEPCIDNGEAFCAYNGL
DMSCAGRIKGDFW*
IP06935.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15200-PA | 113 | CG15200-PA | 1..113 | 1..113 | 653 | 100 | Plus |
CG11106-PB | 112 | CG11106-PB | 4..112 | 3..113 | 139 | 31.5 | Plus |
CG11106-PA | 112 | CG11106-PA | 4..112 | 3..113 | 139 | 31.5 | Plus |
IP06935.pep Sequence
Translation from 113 to 454
> IP06935.pep
MSNGFSFWNGQPVNAPIFPQMGDAINVGSQWSSSVAPGSCGPRTRPMLQS
MGDFQPMRCPPVPPNFFGQPHAMGTGFGDDQGPCEPCIDNGEAFCAYNGL
DMSCAGRIKGDFW*
IP06935.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22588-PA | 139 | GF22588-PA | 1..116 | 1..103 | 217 | 43.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18398-PA | 117 | GG18398-PA | 1..117 | 1..113 | 384 | 66.4 | Plus |
Dere\GG18871-PA | 139 | GG18871-PA | 1..139 | 1..113 | 166 | 36.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15200-PA | 113 | CG15200-PA | 1..113 | 1..113 | 653 | 100 | Plus |
CG11106-PB | 112 | CG11106-PB | 4..112 | 3..113 | 139 | 31.5 | Plus |
CG11106-PA | 112 | CG11106-PA | 4..112 | 3..113 | 139 | 31.5 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL20302-PA | 173 | GL20302-PA | 1..154 | 1..102 | 159 | 35 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13564-PA | 173 | GA13564-PA | 1..154 | 1..102 | 165 | 35.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM11464-PA | 117 | GM11464-PA | 1..117 | 1..113 | 443 | 81.2 | Plus |
Dsec\GM11465-PA | 112 | GM11465-PA | 4..112 | 3..113 | 144 | 35.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17008-PA | 117 | GD17008-PA | 1..117 | 1..113 | 438 | 79.5 | Plus |
Dsim\GD17009-PA | 112 | GD17009-PA | 4..112 | 3..113 | 145 | 35.5 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK16108-PA | 180 | GK16108-PA | 4..145 | 3..103 | 167 | 35.5 | Plus |