Clone IP06935 Report

Search the DGRC for IP06935

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:69
Well:35
Vector:pOT2
Associated Gene/TranscriptCG15200-RA
Protein status:IP06935.pep: gold
Preliminary Size:557
Sequenced Size:551

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15200 2005-01-01 Successful iPCR screen
CG15200 2008-04-29 Release 5.5 accounting
CG15200 2008-08-15 Release 5.9 accounting
CG15200 2008-12-18 5.12 accounting

Clone Sequence Records

IP06935.complete Sequence

551 bp (551 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022621

> IP06935.complete
AGCACATCAAAAATAAATTTTCGGCAGCATTTTTTAAAAGTTTACAAATT
TCGAATTACCAAATTTCGAGATAAAATTCATCCACGATTTTTTTCGAAAT
AAAACATCCAGCCATGTCGAACGGTTTTTCCTTCTGGAACGGACAGCCAG
TGAATGCGCCTATCTTTCCCCAAATGGGTGATGCCATAAACGTTGGTAGC
CAGTGGTCGTCCAGCGTGGCACCAGGATCCTGTGGACCAAGAACTCGACC
GATGCTGCAGAGCATGGGCGATTTCCAGCCGATGAGATGTCCTCCAGTGC
CACCCAACTTCTTTGGCCAGCCGCACGCCATGGGAACTGGATTTGGAGAT
GATCAGGGACCCTGCGAACCCTGCATCGATAATGGAGAAGCCTTCTGCGC
CTACAACGGCTTGGATATGAGCTGTGCCGGGAGAATTAAGGGCGATTTCT
GGTAGTAAATCAGTTGTCCCATCCAAGACCTTCTTGTTCACAAAGTCGTT
GGAATAAATTTTGCATTGTGGTCTCTGCTAGCTCAAAAAAAAAAAAAAAA
A

IP06935.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15200-RA 557 CG15200-RA 13..549 1..537 2685 100 Plus
CG1394-RA 827 CG1394-RA 542..598 366..422 210 91.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:40:25
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11074170..11074703 1..534 2580 98.9 Plus
chrX 22417052 chrX 11061304..11061360 422..366 210 91.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:49:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11182943..11183479 1..537 2685 100 Plus
X 23542271 X 11170051..11170107 422..366 210 91.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11191041..11191577 1..537 2685 100 Plus
X 23527363 X 11178149..11178205 422..366 210 91.2 Minus
Blast to na_te.dros performed on 2019-03-16 09:40:24 has no hits.

IP06935.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:41:22 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11074170..11074703 1..534 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:30:58 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:55 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:04 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:20 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:21 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 1..342 114..455 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:26 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 13..546 1..534 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:55 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 13..546 1..534 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:04 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 13..546 1..534 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:20 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 13..546 1..534 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:21 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
CG15200-RA 13..546 1..534 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:22 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11182943..11183476 1..534 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:22 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11182943..11183476 1..534 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:22 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11182943..11183476 1..534 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:04 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11076976..11077509 1..534 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:54 Download gff for IP06935.complete
Subject Subject Range Query Range Percent Splice Strand
X 11191041..11191574 1..534 100   Plus

IP06935.hyp Sequence

Translation from 113 to 454

> IP06935.hyp
MSNGFSFWNGQPVNAPIFPQMGDAINVGSQWSSSVAPGSCGPRTRPMLQS
MGDFQPMRCPPVPPNFFGQPHAMGTGFGDDQGPCEPCIDNGEAFCAYNGL
DMSCAGRIKGDFW*

IP06935.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15200-PA 113 CG15200-PA 1..113 1..113 653 100 Plus
CG11106-PB 112 CG11106-PB 4..112 3..113 139 31.5 Plus
CG11106-PA 112 CG11106-PA 4..112 3..113 139 31.5 Plus

IP06935.pep Sequence

Translation from 113 to 454

> IP06935.pep
MSNGFSFWNGQPVNAPIFPQMGDAINVGSQWSSSVAPGSCGPRTRPMLQS
MGDFQPMRCPPVPPNFFGQPHAMGTGFGDDQGPCEPCIDNGEAFCAYNGL
DMSCAGRIKGDFW*

IP06935.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22588-PA 139 GF22588-PA 1..116 1..103 217 43.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18398-PA 117 GG18398-PA 1..117 1..113 384 66.4 Plus
Dere\GG18871-PA 139 GG18871-PA 1..139 1..113 166 36.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15200-PA 113 CG15200-PA 1..113 1..113 653 100 Plus
CG11106-PB 112 CG11106-PB 4..112 3..113 139 31.5 Plus
CG11106-PA 112 CG11106-PA 4..112 3..113 139 31.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20302-PA 173 GL20302-PA 1..154 1..102 159 35 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13564-PA 173 GA13564-PA 1..154 1..102 165 35.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11464-PA 117 GM11464-PA 1..117 1..113 443 81.2 Plus
Dsec\GM11465-PA 112 GM11465-PA 4..112 3..113 144 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17008-PA 117 GD17008-PA 1..117 1..113 438 79.5 Plus
Dsim\GD17009-PA 112 GD17009-PA 4..112 3..113 145 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16108-PA 180 GK16108-PA 4..145 3..103 167 35.5 Plus