Clone IP06957 Report

Search the DGRC for IP06957

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:69
Well:57
Vector:pOT2
Associated Gene/TranscriptCG16775-RB
Protein status:IP06957.pep: gold
Preliminary Size:627
Sequenced Size:719

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16775 2005-01-01 Successful iPCR screen
CG16775 2008-04-29 Release 5.5 accounting
CG16775 2008-08-15 Release 5.9 accounting
CG16775 2008-12-18 5.12 accounting

Clone Sequence Records

IP06957.complete Sequence

719 bp (719 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022625

> IP06957.complete
ATCATGTTCTCAGCCAAGAGTTCTGCAATTGTGGCCGTAGTCCTCGTCCA
GATGGTGGCTCAAATCCACGGAGGAGTCTACAGCTATGAGGACAAGTGGG
TGTACCTGGACAAGACCCTGGACCTTCCAGAGGAAGCGATTCTCGGTGGC
GTCGATCCCGATGGTTACTACACCTACGTGGGTCGTGTCACATACAGCAG
TAACATTCTGCCAGCCCGAGTGGTACCGGAGCTGGGAAAGGCCACCTACA
ACACCGACACCTTGGGCAACCAAGCCACCACCTACGAGGTTCTGGTGTCC
AACGCCACTGTCGGCTACCATTGGATCCGTAGTTTCGATGGTTTCCGGGA
AAAGAACGCCGTATCTGTGGGAACCAACGCCCTCAGCGAGCGTGTCTTCA
TCTGTCGTGTCCGCTGTGATGAATCCATCTTTATCGGCACTCTGTACCTT
TCCAAGCGGATGTGCATCGTCAAGTACGACAACTTTCCGCTCCGGCAGTT
CGACAAGTACGAGATCCTTGTCCGCGAACGCCATGTAGCTGCCGTCTCGC
CATTTGTTGATGGTTATATCCACCATTAAATGCTGAGCAACAAAATAAAT
AGAATAAAATATAAATACAAAATATTTATTAAAAAAAAACAATTCCTTTC
AATTTATTTAATGACTTTGAATTAATAAAAATAATTAATATAAAAGCAAA
AAAAAAAAAAAAAAAAAAA

IP06957.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG16775-RB 698 CG16775-RB 2..698 1..697 3485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17875565..17876261 697..1 3485 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17885945..17886644 700..1 3500 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17879045..17879744 700..1 3500 100 Minus
Blast to na_te.dros performed 2019-03-15 19:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1057..1162 695..593 171 66.4 Minus
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 1155..1212 635..695 118 68.9 Plus
blood 7410 blood BLOOD 7410bp 6837..6959 682..565 117 60 Minus
TAHRE 10463 TAHRE OSV 10463bp 2..81 612..693 116 63.4 Plus
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 1992..2030 695..656 107 77.5 Minus

IP06957.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:07:36 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17875671..17876261 1..591 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:02 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 1..576 4..579 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:50 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 1..576 4..579 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:42:03 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 1..576 4..579 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:41 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 1..576 4..579 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:10 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 1..576 4..579 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:59:56 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 2..698 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:50 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 2..698 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:42:03 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 2..698 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:41 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 2..698 1..697 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:10 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
CG16775-RB 2..698 1..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:36 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17885948..17886644 1..697 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:36 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17885948..17886644 1..697 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:36 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17885948..17886644 1..697 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:42:03 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17879048..17879744 1..697 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:44 Download gff for IP06957.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17879048..17879744 1..697 100   Minus

IP06957.hyp Sequence

Translation from 0 to 578

> IP06957.hyp
IMFSAKSSAIVAVVLVQMVAQIHGGVYSYEDKWVYLDKTLDLPEEAILGG
VDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQATTYEVLVS
NATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYL
SKRMCIVKYDNFPLRQFDKYEILVRERHVAAVSPFVDGYIHH*

IP06957.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG16775-PB 191 CG16775-PB 1..191 2..192 998 100 Plus
CG5506-PA 180 CG5506-PA 4..172 10..176 400 48.5 Plus
CG44250-PC 297 CG44250-PC 7..157 24..178 188 31.6 Plus
CG44251-PA 478 CG44251-PA 4..147 32..179 186 34.7 Plus
CG44250-PB 286 CG44250-PB 2..146 30..178 173 30.9 Plus

IP06957.pep Sequence

Translation from 0 to 578

> IP06957.pep
IMFSAKSSAIVAVVLVQMVAQIHGGVYSYEDKWVYLDKTLDLPEEAILGG
VDPDGYYTYVGRVTYSSNILPARVVPELGKATYNTDTLGNQATTYEVLVS
NATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVRCDESIFIGTLYL
SKRMCIVKYDNFPLRQFDKYEILVRERHVAAVSPFVDGYIHH*

IP06957.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25227-PA 186 GF25227-PA 1..184 2..185 685 64.1 Plus
Dana\GF25228-PA 179 GF25228-PA 5..169 10..174 400 48.5 Plus
Dana\GF25229-PA 179 GF25229-PA 25..171 30..176 397 49.7 Plus
Dana\GF21222-PA 672 GF21222-PA 525..672 25..176 188 34.2 Plus
Dana\GF23006-PA 143 GF23006-PA 4..143 33..176 180 29.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15770-PA 191 GG15770-PA 1..191 2..192 842 85.3 Plus
Dere\GG15771-PA 180 GG15771-PA 4..172 11..176 391 46.7 Plus
Dere\GG22534-PA 286 GG22534-PA 2..146 30..178 190 30.9 Plus
Dere\GG22535-PA 469 GG22535-PA 1..144 32..179 188 34 Plus
Dere\GG17790-PA 285 GG17790-PA 6..143 33..175 167 30.1 Plus
Dere\GG17790-PA 285 GG17790-PA 135..284 26..175 149 29 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10743-PA 189 GH10743-PA 1..184 2..185 532 51.1 Plus
Dgri\GH10742-PA 189 GH10742-PA 1..184 2..185 528 51.1 Plus
Dgri\GH10744-PA 189 GH10744-PA 1..179 2..180 517 49.7 Plus
Dgri\GH10740-PA 189 GH10740-PA 1..184 2..185 512 50.5 Plus
Dgri\GH10741-PA 189 GH10741-PA 1..179 2..180 511 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG16775-PB 191 CG16775-PB 1..191 2..192 998 100 Plus
CG5506-PA 180 CG5506-PA 4..172 10..176 400 48.5 Plus
CG44250-PC 297 CG44250-PC 7..157 24..178 188 31.6 Plus
CG44251-PA 478 CG44251-PA 4..147 32..179 186 34.7 Plus
CG44250-PB 286 CG44250-PB 2..146 30..178 173 30.9 Plus
CG32633-PB 285 CG32633-PB 135..284 26..175 164 28.4 Plus
CG32633-PA 285 CG32633-PA 135..284 26..175 164 28.4 Plus
CG32633-PB 285 CG32633-PB 3..141 30..173 159 29.9 Plus
CG32633-PA 285 CG32633-PA 3..141 30..173 159 29.9 Plus
CG31086-PB 148 CG31086-PB 14..143 42..175 155 29.9 Plus
CG31086-PA 148 CG31086-PA 14..143 42..175 155 29.9 Plus
CG13321-PB 286 CG13321-PB 161..285 47..175 146 32.6 Plus
CG13321-PA 286 CG13321-PA 161..285 47..175 146 32.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11542-PA 189 GI11542-PA 1..184 2..185 566 56 Plus
Dmoj\GI17507-PA 189 GI17507-PA 1..184 2..185 562 55.4 Plus
Dmoj\GI17512-PA 186 GI17512-PA 1..175 2..176 560 56.6 Plus
Dmoj\GI10797-PA 189 GI10797-PA 1..184 2..185 542 52.2 Plus
Dmoj\GI11540-PA 181 GI11540-PA 4..172 10..176 430 47.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22739-PA 177 GL22739-PA 1..168 2..185 629 65.8 Plus
Dper\GL22738-PA 173 GL22738-PA 1..145 2..146 519 65.5 Plus
Dper\GL22740-PA 178 GL22740-PA 4..169 9..174 375 44 Plus
Dper\GL21834-PA 148 GL21834-PA 14..143 42..175 165 31.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14139-PA 193 GA14139-PA 1..184 2..185 701 70.1 Plus
Dpse\GA23404-PA 186 GA23404-PA 1..184 2..185 626 65.8 Plus
Dpse\GA18935-PA 178 GA18935-PA 4..169 9..174 375 44 Plus
Dpse\GA15997-PA 148 GA15997-PA 14..143 42..175 171 32.1 Plus
Dpse\GA17750-PA 287 GA17750-PA 2..145 30..177 171 30.4 Plus
Dpse\GA17750-PA 287 GA17750-PA 142..287 26..176 148 29.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24294-PA 191 GM24294-PA 1..191 2..192 890 92.1 Plus
Dsec\GM24295-PA 186 GM24295-PA 1..184 2..185 605 65.8 Plus
Dsec\GM24296-PA 180 GM24296-PA 4..175 11..179 391 45.9 Plus
Dsec\GM20320-PA 297 GM20320-PA 1..157 18..178 194 31.1 Plus
Dsec\GM17616-PA 285 GM17616-PA 3..143 30..175 169 29.5 Plus
Dsec\GM17616-PA 285 GM17616-PA 135..284 26..175 150 29.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12364-PA 186 GD12364-PA 1..184 2..185 617 66.8 Plus
Dsim\GD12365-PA 180 GD12365-PA 4..175 11..179 401 47.1 Plus
Dsim\GD25797-PA 642 GD25797-PA 274..417 32..179 191 34.7 Plus
Dsim\GD25797-PA 642 GD25797-PA 2..146 30..178 181 30.2 Plus
Dsim\GD24809-PA 285 GD24809-PA 3..143 30..175 162 29.5 Plus
Dsim\GD21274-PA 148 GD21274-PA 6..143 33..175 160 28.7 Plus
Dsim\GD24809-PA 285 GD24809-PA 135..284 26..175 150 29.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12837-PA 189 GJ12837-PA 1..184 2..185 606 57.6 Plus
Dvir\GJ12751-PA 189 GJ12751-PA 1..186 2..187 597 57 Plus
Dvir\GJ15279-PA 179 GJ15279-PA 7..176 18..187 585 61.2 Plus
Dvir\GJ12817-PA 187 GJ12817-PA 9..182 12..185 548 54.6 Plus
Dvir\GJ11559-PA 180 GJ11559-PA 4..172 11..176 468 53.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20577-PA 191 GK20577-PA 1..184 2..185 678 66.8 Plus
Dwil\GK20578-PA 172 GK20578-PA 8..172 14..176 432 50.9 Plus
Dwil\GK16750-PA 178 GK16750-PA 29..172 33..174 225 38.6 Plus
Dwil\GK20873-PA 420 GK20873-PA 135..289 30..189 195 33.1 Plus
Dwil\GK20087-PA 285 GK20087-PA 140..284 26..175 185 33.1 Plus
Dwil\GK20087-PA 285 GK20087-PA 3..143 30..175 170 29.5 Plus
Dwil\GK20873-PA 420 GK20873-PA 275..420 26..176 156 29.8 Plus
Dwil\GK20873-PA 420 GK20873-PA 4..145 41..186 155 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22103-PA 191 GE22103-PA 21..191 22..192 823 87.7 Plus
Dyak\GE22104-PA 180 GE22104-PA 7..172 12..176 388 47 Plus
Dyak\GE13407-PA 477 GE13407-PA 5..148 32..179 187 34 Plus
Dyak\GE13405-PA 287 GE13405-PA 4..147 31..178 183 30.4 Plus
Dyak\GE23659-PA 148 GE23659-PA 4..143 31..175 162 28.3 Plus