Clone IP06960 Report

Search the DGRC for IP06960

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:69
Well:60
Vector:pOT2
Associated Gene/TranscriptCG16957-RA
Protein status:IP06960.pep: gold
Preliminary Size:579
Sequenced Size:797

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16957 2005-01-01 Successful iPCR screen
CG16957 2008-04-29 Release 5.5 accounting
CG16957 2008-08-15 Release 5.9 accounting
CG16957 2008-12-18 5.12 accounting

Clone Sequence Records

IP06960.complete Sequence

797 bp (797 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022626

> IP06960.complete
AGTCAGTACAAGGCAGTCGTTAGGGGAGTTTGCATACAATTTTTCACTTC
ATTCATTCACACTCTGGAATTGAAAGCACCAGGATGGCTGAGAGCTCCAA
GGGCATGGAACACACCACCAGCTGGTACTGCAAACTTTACAATTCCCTTA
AGGAAACACCCATCGATGTCACCCTTTTGATCATGTCGATCGTCGTGTTC
CTCAAGTTGGGATTTTTTGCGCGTCGTCTGAGCCGCGAGGAACCAGACTT
CAGTGATGATAATAATCAGGAAGTGGATCTTCCGCCACTGCGGAAGGACT
TTACGGTTCGGGAACTTCGGGAATATGACGGCACACGGGCGGACGGTCGC
ATCCTAGTGGCCATCCTTTTCAACATCTACGATGTCTCGCGATCCGTTCA
CTATTACGGACGAAATGGCGTTAATCCAAACTATGCCGGTCGGGATATTT
CGAGGATTTTGATCAATTCACCAGAGGACTTGAAGGACAGCGAGGATTTT
GATGATTTGAGCGACCTCTCACGCAACCAAATGAACACATTACGAGAGTG
GGAACAGCGGTACAAGATGAAGTACCCATTTGTTGGAAAGCTCAAGGAGA
AACTACAAATCAATGAAGAGGAGGATTTTGAGCTGCAGCAAGCGGATCCG
CTGGTGGACTAAATATGACTTTCGTTTCAAATTAGGCGCGAAATCGATCC
AATAAGAGTAGCTTCCATTGTAAATGACTTAAAATTTTAATTTGTCTGTT
CCAAAATTGCGAAAAACGTAAATAGATTAAAAAAAAAAAAAAAAAAA

IP06960.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG16957-RA 825 CG16957-RA 1..794 1..794 3940 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13394080..13394857 778..1 3875 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13395391..13396184 794..1 3940 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13395391..13396184 794..1 3940 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 19:15:37 has no hits.

IP06960.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:16:40 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13394080..13394857 1..778 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:03 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..579 84..662 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:56 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..579 84..662 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:45 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..579 84..662 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:21 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..579 84..662 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:25:14 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..579 84..662 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:28 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..778 1..778 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:56 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..778 1..778 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:45 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..778 1..778 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:21 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..778 1..778 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:25:14 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
CG16957-RA 1..778 1..778 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:40 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13395407..13396184 1..778 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:40 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13395407..13396184 1..778 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:16:40 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13395407..13396184 1..778 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:45 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13395407..13396184 1..778 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:56 Download gff for IP06960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13395407..13396184 1..778 100   Minus

IP06960.hyp Sequence

Translation from 83 to 661

> IP06960.hyp
MAESSKGMEHTTSWYCKLYNSLKETPIDVTLLIMSIVVFLKLGFFARRLS
REEPDFSDDNNQEVDLPPLRKDFTVRELREYDGTRADGRILVAILFNIYD
VSRSVHYYGRNGVNPNYAGRDISRILINSPEDLKDSEDFDDLSDLSRNQM
NTLREWEQRYKMKYPFVGKLKEKLQINEEEDFELQQADPLVD*

IP06960.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG16957-PB 192 CG16957-PB 1..192 1..192 1001 100 Plus
CG16957-PA 192 CG16957-PA 1..192 1..192 1001 100 Plus
MSBP-PC 248 CG9066-PC 41..197 29..183 305 41.5 Plus
MSBP-PB 248 CG9066-PB 41..197 29..183 305 41.5 Plus
MSBP-PA 248 CG9066-PA 41..197 29..183 305 41.5 Plus

IP06960.pep Sequence

Translation from 83 to 661

> IP06960.pep
MAESSKGMEHTTSWYCKLYNSLKETPIDVTLLIMSIVVFLKLGFFARRLS
REEPDFSDDNNQEVDLPPLRKDFTVRELREYDGTRADGRILVAILFNIYD
VSRSVHYYGRNGVNPNYAGRDISRILINSPEDLKDSEDFDDLSDLSRNQM
NTLREWEQRYKMKYPFVGKLKEKLQINEEEDFELQQADPLVD*

IP06960.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21661-PA 272 GF21661-PA 1..180 1..170 485 56.1 Plus
Dana\GF20506-PA 369 GF20506-PA 17..174 12..173 255 42 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10201-PA 192 GG10201-PA 1..192 1..191 666 67.2 Plus
Dere\GG19361-PA 246 GG19361-PA 29..183 18..173 292 42.1 Plus
Dere\GG10253-PA 217 GG10253-PA 11..145 27..174 158 28.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10626-PA 196 GH10626-PA 18..171 18..170 290 41.1 Plus
Dgri\GH17751-PA 281 GH17751-PA 69..166 73..170 156 33.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG16957-PB 192 CG16957-PB 1..192 1..192 1001 100 Plus
CG16957-PA 192 CG16957-PA 1..192 1..192 1001 100 Plus
MSBP-PC 248 CG9066-PC 41..197 29..183 305 41.5 Plus
MSBP-PB 248 CG9066-PB 41..197 29..183 305 41.5 Plus
MSBP-PA 248 CG9066-PA 41..197 29..183 305 41.5 Plus
t-cup-PA 216 CG31858-PA 53..143 65..170 142 33 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18221-PA 209 GI18221-PA 1..177 1..170 399 46.9 Plus
Dmoj\GI19802-PA 204 GI19802-PA 19..175 12..170 301 40.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14498-PA 120 GL14498-PA 22..115 12..109 170 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21515-PA 139 GA21515-PA 22..115 12..109 167 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25554-PA 180 GM25554-PA 1..180 1..180 806 82.8 Plus
Dsec\GM22513-PA 248 GM22513-PA 41..183 29..173 296 43.4 Plus
Dsec\GM26141-PA 219 GM26141-PA 12..143 27..170 160 29.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22062-PA 196 GD22062-PA 1..194 1..192 852 83.5 Plus
Dsim\GD24671-PA 382 GD24671-PA 39..183 25..173 297 43.6 Plus
Dsim\GD22113-PA 219 GD22113-PA 12..143 27..170 161 29.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18128-PA 206 GJ18128-PA 8..177 5..170 439 52.9 Plus
Dvir\GJ18097-PA 201 GJ18097-PA 16..172 12..170 258 42.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19059-PA 205 GK19059-PA 1..176 1..170 352 49.4 Plus
Dwil\GK16971-PA 180 GK16971-PA 6..174 18..189 273 33.3 Plus
Dwil\GK15245-PA 289 GK15245-PA 56..196 31..173 237 42.7 Plus
Dwil\GK15500-PA 191 GK15500-PA 33..155 50..188 159 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11623-PA 206 GE11623-PA 1..204 1..188 676 66.2 Plus
Dyak\GE16009-PA 246 GE16009-PA 29..183 18..173 303 44 Plus
Dyak\GE12218-PA 217 GE12218-PA 51..145 65..174 149 33.6 Plus