Clone IP06967 Report

Search the DGRC for IP06967

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:69
Well:67
Vector:pOT2
Associated Gene/TranscriptCG18193-RA
Protein status:IP06967.pep: gold
Preliminary Size:584
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18193 2005-01-01 Successful iPCR screen
CG18193 2008-04-29 Release 5.5 accounting
CG18193 2008-08-15 Release 5.9 accounting
CG18193 2008-12-18 5.12 accounting

Clone Sequence Records

IP06967.complete Sequence

587 bp (587 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022629

> IP06967.complete
ATAGTGTCACTTAAACATTATTCGATAGTTAAAGGCAGACAAAATTTTGT
TCCGAATACTCCAGAAAGTTTCAGGAAACGTAAATGCAAAGAAACTGTTT
CTCTTTGCGCCCCTTCCTTCGGGGAGTCGGTGATGTGGGTGCAGTTTGTA
AGCCCATTCGTGAATTTCGCAACTCGGCTGCTTTGAAATATGCTGCTGCT
GCAGCTGCAGCTCCGAAGACACGTCCTGGAAAAGTTCCTCCAAAAATGGT
CAAATTGAGGAAGCAATTTCAGGCGGACAATGATTTGCCGATTTTTCTAA
AAGGCGGCAGTATGGATAACATATTATACAGACTCACCTGGGTGCTCTGC
TTCCTCGGCATAGGTGGCGATGTATGGTTGTGGCTTGGCTATATCATTGC
CTAAAATCAACAGAGATCATGCAAGCAAGCCCACAAAACACAAATACTCT
GTACACGAATGCAAATACCAATTGTAACGACACATACATTAGTTAACTAG
TAACGTTTCTGTACATAGGTAGTTCAAATACGGAAAATCAATTATATAAT
AATAATAATGTGCTTTAAAAAAAAAAAAAAAAAAAAA

IP06967.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG18193-RA 663 CG18193-RA 85..651 1..567 2835 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4169868..4170323 111..566 2280 100 Plus
chr3R 27901430 chr3R 4169703..4169812 1..110 550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8343855..8344311 111..567 2285 100 Plus
3R 32079331 3R 8343690..8343799 1..110 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8084686..8085142 111..567 2285 100 Plus
3R 31820162 3R 8084521..8084630 1..110 550 100 Plus
Blast to na_te.dros performed 2019-03-16 06:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1059..1229 565..402 109 54.4 Minus

IP06967.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:17:15 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4169703..4169812 1..110 100 -> Plus
chr3R 4169868..4170323 111..566 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:04 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:57 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:22 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:22 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:21 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 1..321 84..404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:30 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 11..576 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:57 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 11..576 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:22 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 22..587 1..566 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:22 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 11..576 1..566 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:21 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 22..587 1..566 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:15 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8343690..8343799 1..110 100 -> Plus
3R 8343855..8344310 111..566 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:15 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8343690..8343799 1..110 100 -> Plus
3R 8343855..8344310 111..566 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:15 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8343690..8343799 1..110 100 -> Plus
3R 8343855..8344310 111..566 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:22 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4169412..4169521 1..110 100 -> Plus
arm_3R 4169577..4170032 111..566 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:57 Download gff for IP06967.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8084686..8085141 111..566 100   Plus
3R 8084521..8084630 1..110 100 -> Plus

IP06967.hyp Sequence

Translation from 83 to 403

> IP06967.hyp
MQRNCFSLRPFLRGVGDVGAVCKPIREFRNSAALKYAAAAAAAPKTRPGK
VPPKMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLCFLGIGGDVWLW
LGYIIA*

IP06967.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG18193-PA 106 CG18193-PA 1..106 1..106 565 100 Plus

IP06967.pep Sequence

Translation from 83 to 403

> IP06967.pep
MQRNCFSLRPFLRGVGDVGAVCKPIREFRNSAALKYAAAAAAAPKTRPGK
VPPKMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLCFLGIGGDVWLW
LGYIIA*

IP06967.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18346-PA 103 GF18346-PA 1..103 1..106 357 68.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10146-PA 103 GG10146-PA 1..103 1..106 478 87.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14239-PA 52 GH14239-PA 1..52 55..106 207 73.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
COX7AL-PA 106 CG18193-PA 1..106 1..106 565 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24872-PA 69 GI24872-PA 13..69 50..106 182 57.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23433-PA 251 GL23433-PA 28..75 49..96 176 64.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14835-PA 161 GA14835-PA 97..159 43..105 225 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23727-PA 106 GM23727-PA 1..106 1..106 435 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CoVIIa-PA 105 GD18537-PA 1..105 1..106 522 96.2 Plus
Dsim\GD20874-PA 89 GD20874-PA 9..75 25..95 130 38 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24515-PA 66 GJ24515-PA 8..66 48..106 163 62.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13185-PA 52 GK13185-PA 1..52 55..106 195 69.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25872-PA 105 GE25872-PA 1..105 1..106 486 93.4 Plus