BDGP Sequence Production Resources |
Search the DGRC for IP06967
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 69 |
Well: | 67 |
Vector: | pOT2 |
Associated Gene/Transcript | CG18193-RA |
Protein status: | IP06967.pep: gold |
Preliminary Size: | 584 |
Sequenced Size: | 587 |
Gene | Date | Evidence |
---|---|---|
CG18193 | 2005-01-01 | Successful iPCR screen |
CG18193 | 2008-04-29 | Release 5.5 accounting |
CG18193 | 2008-08-15 | Release 5.9 accounting |
CG18193 | 2008-12-18 | 5.12 accounting |
587 bp (587 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022629
> IP06967.complete ATAGTGTCACTTAAACATTATTCGATAGTTAAAGGCAGACAAAATTTTGT TCCGAATACTCCAGAAAGTTTCAGGAAACGTAAATGCAAAGAAACTGTTT CTCTTTGCGCCCCTTCCTTCGGGGAGTCGGTGATGTGGGTGCAGTTTGTA AGCCCATTCGTGAATTTCGCAACTCGGCTGCTTTGAAATATGCTGCTGCT GCAGCTGCAGCTCCGAAGACACGTCCTGGAAAAGTTCCTCCAAAAATGGT CAAATTGAGGAAGCAATTTCAGGCGGACAATGATTTGCCGATTTTTCTAA AAGGCGGCAGTATGGATAACATATTATACAGACTCACCTGGGTGCTCTGC TTCCTCGGCATAGGTGGCGATGTATGGTTGTGGCTTGGCTATATCATTGC CTAAAATCAACAGAGATCATGCAAGCAAGCCCACAAAACACAAATACTCT GTACACGAATGCAAATACCAATTGTAACGACACATACATTAGTTAACTAG TAACGTTTCTGTACATAGGTAGTTCAAATACGGAAAATCAATTATATAAT AATAATAATGTGCTTTAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18193-RA | 663 | CG18193-RA | 85..651 | 1..567 | 2835 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1059..1229 | 565..402 | 109 | 54.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4169703..4169812 | 1..110 | 100 | -> | Plus |
chr3R | 4169868..4170323 | 111..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 1..321 | 84..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 1..321 | 84..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 1..321 | 84..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 1..321 | 84..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 1..321 | 84..404 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 11..576 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 11..576 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 22..587 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 11..576 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18193-RA | 22..587 | 1..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8343690..8343799 | 1..110 | 100 | -> | Plus |
3R | 8343855..8344310 | 111..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8343690..8343799 | 1..110 | 100 | -> | Plus |
3R | 8343855..8344310 | 111..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8343690..8343799 | 1..110 | 100 | -> | Plus |
3R | 8343855..8344310 | 111..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4169412..4169521 | 1..110 | 100 | -> | Plus |
arm_3R | 4169577..4170032 | 111..566 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8084686..8085141 | 111..566 | 100 | Plus | |
3R | 8084521..8084630 | 1..110 | 100 | -> | Plus |
Translation from 83 to 403
> IP06967.hyp MQRNCFSLRPFLRGVGDVGAVCKPIREFRNSAALKYAAAAAAAPKTRPGK VPPKMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLCFLGIGGDVWLW LGYIIA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18193-PA | 106 | CG18193-PA | 1..106 | 1..106 | 565 | 100 | Plus |
Translation from 83 to 403
> IP06967.pep MQRNCFSLRPFLRGVGDVGAVCKPIREFRNSAALKYAAAAAAAPKTRPGK VPPKMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLCFLGIGGDVWLW LGYIIA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18346-PA | 103 | GF18346-PA | 1..103 | 1..106 | 357 | 68.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10146-PA | 103 | GG10146-PA | 1..103 | 1..106 | 478 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14239-PA | 52 | GH14239-PA | 1..52 | 55..106 | 207 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
COX7AL-PA | 106 | CG18193-PA | 1..106 | 1..106 | 565 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24872-PA | 69 | GI24872-PA | 13..69 | 50..106 | 182 | 57.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23433-PA | 251 | GL23433-PA | 28..75 | 49..96 | 176 | 64.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14835-PA | 161 | GA14835-PA | 97..159 | 43..105 | 225 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23727-PA | 106 | GM23727-PA | 1..106 | 1..106 | 435 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\CoVIIa-PA | 105 | GD18537-PA | 1..105 | 1..106 | 522 | 96.2 | Plus |
Dsim\GD20874-PA | 89 | GD20874-PA | 9..75 | 25..95 | 130 | 38 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24515-PA | 66 | GJ24515-PA | 8..66 | 48..106 | 163 | 62.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13185-PA | 52 | GK13185-PA | 1..52 | 55..106 | 195 | 69.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25872-PA | 105 | GE25872-PA | 1..105 | 1..106 | 486 | 93.4 | Plus |