Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP06990.complete Sequence
804 bp (804 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022634
> IP06990.complete
CAAGCTGAAACATATCAAACTCCGGAAGTAAGCAGGCATGATGTCGAAAG
ATTTTGATTTTTCTCAGAAGGGTATGAGCGACGCCACTAGTAGCGACTTA
CGTAACGAGTCAGCACATCCAACATTCTCTGGGACTAAGCAACTTTTCAC
GTTAAGCTCGCCGTTTTACCAGGGACCCACGTCCTTTGGCGGTAGTGCGG
CTATTACTCGCGTTTGGAACAATTTTAAGTGCAGCAGAATACTTGCTTCT
GAAATCAACAAAAAGATGGAACCGCCAACTTATTCGGAGTCCTTAGAGTC
GAAGATCATGAAACGCCGTCGTCTGTACGCTCTTTTAAATAGGAAAGAAA
TTACGTATAGCAAATACCGGAATATACAGAATGAGTCCCGGATAGGAATC
ATTAAAGAGGTGGAGGAAACACAAATGCCAGAAACCACATATAAGAAGAA
ATCGCCTACGAAACCAGTTATGCGAACATTCTACTTCTCGGAGCCTATAC
CGCTAATGCAACATAATTCAAAGCGCAATTTTGTATTTTCCGACCCAATT
CCTCTGGATTAGGATACTTGTTTGTTTTACAAATTTTTCAAATATTTCTA
AATTGTTTGAATATAGAAGGTGTTTCTGTGTATTACGTTGATCGGTTAAA
GCCTAGCTATACAAAGAAAATACAATATTTTCTTTTATTTTAAAATTAAA
ATCAAATTTTTGTAGCACAAATTCGTTGCACTATTGTAAGATATAACTGA
TGAATTTGTTCTTAAATAAAAGTGAATTTGCTTTCAAAAAAAAAAAAAAA
AAAA
IP06990.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:45:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30447-RA | 829 | CG30447-RA | 42..829 | 1..788 | 3940 | 100 | Plus |
CG30447-RB | 825 | CG30447-RB | 42..825 | 1..788 | 3855 | 99.4 | Plus |
CG30447.a | 822 | CG30447.a | 42..822 | 1..788 | 3810 | 99.1 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:31:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 15834494..15835253 | 26..785 | 3695 | 99.1 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:31:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 19947321..19948083 | 26..788 | 3815 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 19948520..19949282 | 26..788 | 3815 | 100 | Plus |
2R | 25260384 | 2R | 19948422..19948449 | 1..28 | 140 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 21:31:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Damb\P-element_T | 3329 | Damb\P-element_T P_T 3329bp Derived from AF012414. | 2543..2674 | 710..577 | 140 | 62.8 | Minus |
Damb\P-element_T | 3329 | Damb\P-element_T P_T 3329bp Derived from AF012414. | 2543..2619 | 675..748 | 134 | 67.5 | Plus |
Transpac | 5249 | Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). | 4018..4072 | 615..560 | 115 | 69.6 | Minus |
G4 | 3856 | G4 G4_DM 3856bp | 195..255 | 659..720 | 109 | 66.1 | Plus |
Stalker4 | 7359 | Stalker4 STALKER4 7359bp | 1358..1407 | 711..661 | 108 | 70.6 | Minus |
Stalker | 7256 | Stalker STALKER 7256bp | 1250..1299 | 711..661 | 108 | 70.6 | Minus |
IP06990.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:32:07 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 15834396..15834423 | 1..28 | 100 | -> | Plus |
chr2R | 15834497..15835253 | 29..785 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:09 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RB | 1..525 | 38..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:38 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RB | 1..525 | 38..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:51:01 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 1..525 | 38..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:05 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 1..525 | 38..562 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:06 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 1..525 | 38..562 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:59 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 3..787 | 1..785 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:38 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 3..787 | 1..785 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:51:01 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 3..787 | 1..785 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:05 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 1..542 | 21..562 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:06 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30447-RA | 1..785 | 1..785 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:07 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19947223..19947250 | 1..28 | 100 | -> | Plus |
2R | 19947324..19948080 | 29..785 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:07 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19947223..19947250 | 1..28 | 100 | -> | Plus |
2R | 19947324..19948080 | 29..785 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:07 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19947223..19947250 | 1..28 | 100 | -> | Plus |
2R | 19947324..19948080 | 29..785 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:51:01 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 15834728..15834755 | 1..28 | 100 | -> | Plus |
arm_2R | 15834829..15835585 | 29..785 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:38 Download gff for
IP06990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19948523..19949279 | 29..785 | 100 | | Plus |
2R | 19948422..19948449 | 1..28 | 100 | -> | Plus |
IP06990.pep Sequence
Translation from 37 to 561
> IP06990.pep
MMSKDFDFSQKGMSDATSSDLRNESAHPTFSGTKQLFTLSSPFYQGPTSF
GGSAAITRVWNNFKCSRILASEINKKMEPPTYSESLESKIMKRRRLYALL
NRKEITYSKYRNIQNESRIGIIKEVEETQMPETTYKKKSPTKPVMRTFYF
SEPIPLMQHNSKRNFVFSDPIPLD*
IP06990.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22007-PA | 165 | GG22007-PA | 10..165 | 14..174 | 419 | 56.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30447-PC | 174 | CG30447-PC | 1..174 | 1..174 | 903 | 100 | Plus |
CG30447-PB | 174 | CG30447-PB | 1..174 | 1..174 | 903 | 100 | Plus |
CG30447-PA | 174 | CG30447-PA | 1..174 | 1..174 | 903 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21986-PA | 94 | GM21986-PA | 1..94 | 77..174 | 374 | 76.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11486-PA | 153 | GD11486-PA | 2..153 | 19..174 | 621 | 78.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12085-PA | 166 | GE12085-PA | 1..166 | 1..173 | 466 | 56.6 | Plus |
IP06990.hyp Sequence
Translation from 37 to 561
> IP06990.hyp
MMSKDFDFSQKGMSDATSSDLRNESAHPTFSGTKQLFTLSSPFYQGPTSF
GGSAAITRVWNNFKCSRILASEINKKMEPPTYSESLESKIMKRRRLYALL
NRKEITYSKYRNIQNESRIGIIKEVEETQMPETTYKKKSPTKPVMRTFYF
SEPIPLMQHNSKRNFVFSDPIPLD*
IP06990.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:05:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30447-PC | 174 | CG30447-PC | 1..174 | 1..174 | 903 | 100 | Plus |
CG30447-PB | 174 | CG30447-PB | 1..174 | 1..174 | 903 | 100 | Plus |
CG30447-PA | 174 | CG30447-PA | 1..174 | 1..174 | 903 | 100 | Plus |