Clone IP06990 Report

Search the DGRC for IP06990

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:69
Well:90
Vector:pOT2
Associated Gene/TranscriptCG30447-RA
Protein status:IP06990.pep: gold
Preliminary Size:542
Sequenced Size:804

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30447 2005-01-01 Successful iPCR screen
CG30447 2008-04-29 Release 5.5 accounting
CG30447 2008-08-15 Release 5.9 accounting
CG30447 2008-12-18 5.12 accounting

Clone Sequence Records

IP06990.complete Sequence

804 bp (804 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022634

> IP06990.complete
CAAGCTGAAACATATCAAACTCCGGAAGTAAGCAGGCATGATGTCGAAAG
ATTTTGATTTTTCTCAGAAGGGTATGAGCGACGCCACTAGTAGCGACTTA
CGTAACGAGTCAGCACATCCAACATTCTCTGGGACTAAGCAACTTTTCAC
GTTAAGCTCGCCGTTTTACCAGGGACCCACGTCCTTTGGCGGTAGTGCGG
CTATTACTCGCGTTTGGAACAATTTTAAGTGCAGCAGAATACTTGCTTCT
GAAATCAACAAAAAGATGGAACCGCCAACTTATTCGGAGTCCTTAGAGTC
GAAGATCATGAAACGCCGTCGTCTGTACGCTCTTTTAAATAGGAAAGAAA
TTACGTATAGCAAATACCGGAATATACAGAATGAGTCCCGGATAGGAATC
ATTAAAGAGGTGGAGGAAACACAAATGCCAGAAACCACATATAAGAAGAA
ATCGCCTACGAAACCAGTTATGCGAACATTCTACTTCTCGGAGCCTATAC
CGCTAATGCAACATAATTCAAAGCGCAATTTTGTATTTTCCGACCCAATT
CCTCTGGATTAGGATACTTGTTTGTTTTACAAATTTTTCAAATATTTCTA
AATTGTTTGAATATAGAAGGTGTTTCTGTGTATTACGTTGATCGGTTAAA
GCCTAGCTATACAAAGAAAATACAATATTTTCTTTTATTTTAAAATTAAA
ATCAAATTTTTGTAGCACAAATTCGTTGCACTATTGTAAGATATAACTGA
TGAATTTGTTCTTAAATAAAAGTGAATTTGCTTTCAAAAAAAAAAAAAAA
AAAA

IP06990.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG30447-RA 829 CG30447-RA 42..829 1..788 3940 100 Plus
CG30447-RB 825 CG30447-RB 42..825 1..788 3855 99.4 Plus
CG30447.a 822 CG30447.a 42..822 1..788 3810 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15834494..15835253 26..785 3695 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19947321..19948083 26..788 3815 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19948520..19949282 26..788 3815 100 Plus
2R 25260384 2R 19948422..19948449 1..28 140 100 Plus
Blast to na_te.dros performed 2019-03-15 21:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 2543..2674 710..577 140 62.8 Minus
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 2543..2619 675..748 134 67.5 Plus
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 4018..4072 615..560 115 69.6 Minus
G4 3856 G4 G4_DM 3856bp 195..255 659..720 109 66.1 Plus
Stalker4 7359 Stalker4 STALKER4 7359bp 1358..1407 711..661 108 70.6 Minus
Stalker 7256 Stalker STALKER 7256bp 1250..1299 711..661 108 70.6 Minus

IP06990.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:32:07 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15834396..15834423 1..28 100 -> Plus
chr2R 15834497..15835253 29..785 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:09 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RB 1..525 38..562 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:38 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RB 1..525 38..562 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:51:01 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 1..525 38..562 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:05 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 1..525 38..562 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:06 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 1..525 38..562 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:59 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 3..787 1..785 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:38 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 3..787 1..785 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:51:01 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 3..787 1..785 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:05 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 1..542 21..562 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:06 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
CG30447-RA 1..785 1..785 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:07 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19947223..19947250 1..28 100 -> Plus
2R 19947324..19948080 29..785 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:07 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19947223..19947250 1..28 100 -> Plus
2R 19947324..19948080 29..785 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:07 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19947223..19947250 1..28 100 -> Plus
2R 19947324..19948080 29..785 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:51:01 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15834728..15834755 1..28 100 -> Plus
arm_2R 15834829..15835585 29..785 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:38 Download gff for IP06990.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19948523..19949279 29..785 100   Plus
2R 19948422..19948449 1..28 100 -> Plus

IP06990.pep Sequence

Translation from 37 to 561

> IP06990.pep
MMSKDFDFSQKGMSDATSSDLRNESAHPTFSGTKQLFTLSSPFYQGPTSF
GGSAAITRVWNNFKCSRILASEINKKMEPPTYSESLESKIMKRRRLYALL
NRKEITYSKYRNIQNESRIGIIKEVEETQMPETTYKKKSPTKPVMRTFYF
SEPIPLMQHNSKRNFVFSDPIPLD*

IP06990.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22007-PA 165 GG22007-PA 10..165 14..174 419 56.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG30447-PC 174 CG30447-PC 1..174 1..174 903 100 Plus
CG30447-PB 174 CG30447-PB 1..174 1..174 903 100 Plus
CG30447-PA 174 CG30447-PA 1..174 1..174 903 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21986-PA 94 GM21986-PA 1..94 77..174 374 76.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11486-PA 153 GD11486-PA 2..153 19..174 621 78.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12085-PA 166 GE12085-PA 1..166 1..173 466 56.6 Plus

IP06990.hyp Sequence

Translation from 37 to 561

> IP06990.hyp
MMSKDFDFSQKGMSDATSSDLRNESAHPTFSGTKQLFTLSSPFYQGPTSF
GGSAAITRVWNNFKCSRILASEINKKMEPPTYSESLESKIMKRRRLYALL
NRKEITYSKYRNIQNESRIGIIKEVEETQMPETTYKKKSPTKPVMRTFYF
SEPIPLMQHNSKRNFVFSDPIPLD*

IP06990.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30447-PC 174 CG30447-PC 1..174 1..174 903 100 Plus
CG30447-PB 174 CG30447-PB 1..174 1..174 903 100 Plus
CG30447-PA 174 CG30447-PA 1..174 1..174 903 100 Plus