Clone IP07017 Report

Search the DGRC for IP07017

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:70
Well:17
Vector:pOT2
Associated Gene/TranscriptCG14854-RB
Protein status:IP07017.pep: gold
Preliminary Size:543
Sequenced Size:686

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14854 2005-01-01 Successful iPCR screen
CG14854 2008-04-29 Release 5.5 accounting
CG14854 2008-08-15 Release 5.9 accounting
CG14854 2008-12-18 5.12 accounting

Clone Sequence Records

IP07017.complete Sequence

686 bp (686 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022642

> IP07017.complete
TGAGCCATGGATTTGTTTAGCTCTCTGCTGCTGTGCCTGGGAATTATTTC
ATTACCCAATGTGTTTACGATTTGCATTCCGCCCAATCACTGCATTGAAG
ATATGGAGGAAAGCGATGCGAAAGAGCGATTCGACTATGTACTTGGCAAA
TATGAGGAGGTGGAAATGAATATTCCCGGAAAACCAGTTGGTTTGTATGG
GAAAGTGGTTACGCATGGCGAGGCGGAGGAGCAGCACTTGGTGTTCCAGT
ACATGGACAATACGCTGCATGACATCATCCAGACGTGTGCGTTTGTGGTC
AAGCGGAATCCCGGTGAGTGCGAGAACATCCGCACCTACTGCTCGGCCTT
TCTGAGCCGCCTGCCACGCCCCCTGCTGGAGCGCAAGCCCATCAACGTGT
GTGACGATGGGACGCGAGTGGCGGAGGACGAGCCGGAAACGGAAGCGGAA
GACAATCCGGATGCAGATGCTGAGGGGGAGACTGATCCGCAGCAGGAGCA
GGGAGTTGGTCAAGCGGAGACCACAACAGCGGAGCCGGCTAGCTCCAAAT
TAAGTGAATTTTATTGAGTGGGGTGCAATGTCATCCGGCGGTTTGTTCAT
TCATCTCGACATTTAAAAGACAATTAAACGCACAATTGTAAAATAAGTGC
ATAAGTAAGTGCAAAAAAAAAAAAAAAAAAAAAAAA

IP07017.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14854-RB 839 CG14854-RB 47..710 1..664 3320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10383922..10384393 662..191 2360 100 Minus
chr3R 27901430 chr3R 10384458..10384546 191..103 445 100 Minus
chr3R 27901430 chr3R 10384747..10384809 63..1 315 100 Minus
chr3R 27901430 chr3R 10384652..10384691 102..63 200 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14559164..14559637 664..191 2370 100 Minus
3R 32079331 3R 14559702..14559790 191..103 445 100 Minus
3R 32079331 3R 14559991..14560053 63..1 315 100 Minus
3R 32079331 3R 14559896..14559935 102..63 200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14299995..14300468 664..191 2370 100 Minus
3R 31820162 3R 14300533..14300621 191..103 445 100 Minus
3R 31820162 3R 14300822..14300884 63..1 315 100 Minus
3R 31820162 3R 14300727..14300766 102..63 200 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:31:33 has no hits.

IP07017.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:32:24 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10383922..10384392 192..662 100 <- Minus
chr3R 10384458..10384546 103..191 100 <- Minus
chr3R 10384652..10384690 64..102 100 <- Minus
chr3R 10384747..10384809 1..63 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:13 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 1..561 7..567 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:57 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 1..561 7..567 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:51:37 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 1..561 7..567 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:44 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 1..561 7..567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:37 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 1..561 7..567 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:49 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 2..663 1..662 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:57 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 2..663 1..662 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:51:37 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 2..663 1..662 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:44 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 2..663 1..662 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:37 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
CG14854-RB 2..663 1..662 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:24 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14559166..14559636 192..662 100 <- Minus
3R 14559702..14559790 103..191 100 <- Minus
3R 14559896..14559934 64..102 100 <- Minus
3R 14559991..14560053 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:24 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14559166..14559636 192..662 100 <- Minus
3R 14559702..14559790 103..191 100 <- Minus
3R 14559896..14559934 64..102 100 <- Minus
3R 14559991..14560053 1..63 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:24 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14559166..14559636 192..662 100 <- Minus
3R 14559702..14559790 103..191 100 <- Minus
3R 14559896..14559934 64..102 100 <- Minus
3R 14559991..14560053 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:51:37 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10384888..10385358 192..662 100 <- Minus
arm_3R 10385424..10385512 103..191 100 <- Minus
arm_3R 10385618..10385656 64..102 100 <- Minus
arm_3R 10385713..10385775 1..63 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:24 Download gff for IP07017.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14299997..14300467 192..662 100 <- Minus
3R 14300533..14300621 103..191 100 <- Minus
3R 14300727..14300765 64..102 100 <- Minus
3R 14300822..14300884 1..63 100   Minus

IP07017.hyp Sequence

Translation from 6 to 566

> IP07017.hyp
MDLFSSLLLCLGIISLPNVFTICIPPNHCIEDMEESDAKERFDYVLGKYE
EVEMNIPGKPVGLYGKVVTHGEAEEQHLVFQYMDNTLHDIIQTCAFVVKR
NPGECENIRTYCSAFLSRLPRPLLERKPINVCDDGTRVAEDEPETEAEDN
PDADAEGETDPQQEQGVGQAETTTAEPASSKLSEFY*

IP07017.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14854-PB 186 CG14854-PB 1..186 1..186 990 100 Plus

IP07017.pep Sequence

Translation from 6 to 566

> IP07017.pep
MDLFSSLLLCLGIISLPNVFTICIPPNHCIEDMEESDAKERFDYVLGKYE
EVEMNIPGKPVGLYGKVVTHGEAEEQHLVFQYMDNTLHDIIQTCAFVVKR
NPGECENIRTYCSAFLSRLPRPLLERKPINVCDDGTRVAEDEPETEAEDN
PDADAEGETDPQQEQGVGQAETTTAEPASSKLSEFY*

IP07017.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17477-PA 230 GF17477-PA 1..129 33..161 499 71.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21251-PA 189 GG21251-PA 1..189 1..186 930 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14133-PA 324 GH14133-PA 154..307 15..164 427 53.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14854-PB 186 CG14854-PB 1..186 1..186 990 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10666-PA 181 GI10666-PA 17..132 20..135 453 67.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24174-PA 185 GL24174-PA 1..142 1..140 510 68.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13296-PA 185 GA13296-PA 1..184 1..185 522 59.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25847-PA 180 GM25847-PA 27..180 33..186 789 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15104-PA 69 GD15104-PA 10..69 3..62 237 73.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23018-PA 185 GJ23018-PA 1..138 1..137 465 61.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11354-PA 151 GK11354-PA 1..105 33..137 447 75.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26444-PA 171 GE26444-PA 18..171 33..186 725 94.2 Plus