BDGP Sequence Production Resources |
Search the DGRC for IP07019
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 70 |
Well: | 19 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14931-RB |
Protein status: | IP07019.pep: gold |
Preliminary Size: | 591 |
Sequenced Size: | 877 |
Gene | Date | Evidence |
---|---|---|
CG14931 | 2005-01-01 | Successful iPCR screen |
CG14931 | 2008-04-29 | Release 5.5 accounting |
CG14931 | 2008-08-15 | Release 5.9 accounting |
CG14931 | 2008-12-18 | 5.12 accounting |
877 bp (877 high quality bases) assembled on 2006-09-27
GenBank Submission: BT029058
> IP07019.complete TAACCACATAATATTAGTACTAAAGTTGTTGTTTTTGTCCCATTGAAAAT GGAGTTACGCAGCCGAACAAACAGGAGATTAGTTGACTTCCTCAAAAGCG CAGGCGTTTACGAGGAAGGCATGGATATTGAGGAAATGACCGAATTAGCA AGTGTCGTGCAGCAATCAGCTAGTATCAGTCCCCAGGATGAGGATCTAGA AAGGGCTCTGCACGAGAGCGAGTCTGATTTTTTGACTTCGCATCCCAGTG CTTTGCACAACTCCACGATGATCATGTCGCCGCAAGTGTCCAGAAGAAAT CCCTCAGACATGGACAGTCCACCGAGCGAGCCGATCCGTATAACTTTTCG GGCTTTGGTGCACCGTGCCATGGACTGGAGTCCCACCACGGGCAATCAAA TTCCCGATCGCAAGCGCATTGCTGCGGATCGCAATCAAAACGTCGAACTA GTTGGCAAACGTTCCAGAGCAACGCCGGCTATCAGCATTGGCCAGGCACC GGAGGATGAGCCGCACAATGCCGACGCCACACCCGTTTCCCCGGGCAACG AATGCGACTCCGGCGTCAGCTGGGAGGAGATATCTTTGTCCAGCGCCAGC GATAGCACCACTCTTCCTTCCATCGGCGAAATGCCCGATCGACATTTAAT CAGCACCAGCAGCGTCGCCGTCTCGGATTTCTCAGATGCCAATGAAATCA GCCAGGAATAGGCTATTTCCGCCCATGTCTTGTGGTTTATGTTTCCCAAT CGAATGCAGTAGAGATTTTACAATGTTTATAGCCCACATATGTCTAAGAA AGAGTACTCGAATAAGTTAACTATATGTCACATTAAAGGATTGAATTTAT TGCATAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14931-RB | 1155 | CG14931-RB | 209..1065 | 1..857 | 4285 | 100 | Plus |
CG14931.a | 917 | CG14931.a | 43..893 | 1..857 | 4170 | 99.2 | Plus |
CG14931.b | 899 | CG14931.b | 258..899 | 214..855 | 3210 | 100 | Plus |
CG14931.b | 899 | CG14931.b | 36..249 | 1..214 | 1070 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 11787469..11788110 | 214..855 | 3210 | 100 | Plus |
chr2L | 23010047 | chr2L | 11787288..11787404 | 98..214 | 585 | 100 | Plus |
chr2L | 23010047 | chr2L | 11787129..11787226 | 1..98 | 490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 11787129..11787225 | 1..97 | 100 | -> | Plus |
chr2L | 11787288..11787403 | 98..213 | 100 | -> | Plus |
chr2L | 11787469..11788110 | 214..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 1..663 | 49..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 1..663 | 49..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 1..663 | 49..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RA | 1..591 | 121..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 1..663 | 49..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 34..888 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 34..888 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 58..912 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RA | 1..591 | 121..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14931-RB | 58..912 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11788494..11788590 | 1..97 | 100 | -> | Plus |
2L | 11788653..11788768 | 98..213 | 100 | -> | Plus |
2L | 11788834..11789475 | 214..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11788494..11788590 | 1..97 | 100 | -> | Plus |
2L | 11788653..11788768 | 98..213 | 100 | -> | Plus |
2L | 11788834..11789475 | 214..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11788494..11788590 | 1..97 | 100 | -> | Plus |
2L | 11788653..11788768 | 98..213 | 100 | -> | Plus |
2L | 11788834..11789475 | 214..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 11788494..11788590 | 1..97 | 100 | -> | Plus |
arm_2L | 11788653..11788768 | 98..213 | 100 | -> | Plus |
arm_2L | 11788834..11789475 | 214..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11788834..11789475 | 214..855 | 100 | Plus | |
2L | 11788494..11788590 | 1..97 | 100 | -> | Plus |
2L | 11788653..11788768 | 98..213 | 100 | -> | Plus |
Translation from 48 to 710
> IP07019.hyp MELRSRTNRRLVDFLKSAGVYEEGMDIEEMTELASVVQQSASISPQDEDL ERALHESESDFLTSHPSALHNSTMIMSPQVSRRNPSDMDSPPSEPIRITF RALVHRAMDWSPTTGNQIPDRKRIAADRNQNVELVGKRSRATPAISIGQA PEDEPHNADATPVSPGNECDSGVSWEEISLSSASDSTTLPSIGEMPDRHL ISTSSVAVSDFSDANEISQE*
Translation from 48 to 710
> IP07019.pep MELRSRTNRRLVDFLKSAGVYEEGMDIEEMTELASVVQQSASISPQDEDL ERALHESESDFLTSHPSALHNSTMIMSPQVSRRNPSDMDSPPSEPIRITF RALVHRAMDWSPTTGNQIPDRKRIAADRNQNVELVGKRSRATPAISIGQA PEDEPHNADATPVSPGNECDSGVSWEEISLSSASDSTTLPSIGEMPDRHL ISTSSVAVSDFSDANEISQE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14570-PA | 201 | GF14570-PA | 1..198 | 25..216 | 300 | 47.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23733-PA | 221 | GG23733-PA | 1..221 | 1..220 | 911 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11371-PA | 242 | GH11371-PA | 1..228 | 1..216 | 243 | 35.5 | Plus |
Dgri\GH23430-PA | 242 | GH23430-PA | 1..228 | 1..216 | 241 | 35.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14931-PB | 220 | CG14931-PB | 1..220 | 1..220 | 1117 | 100 | Plus |
CG14931-PC | 223 | CG14931-PC | 1..223 | 1..220 | 1103 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18076-PA | 214 | GI18076-PA | 1..213 | 1..218 | 334 | 41.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19316-PA | 238 | GL19316-PA | 1..227 | 1..215 | 299 | 39.1 | Plus |
Dper\GL18317-PA | 215 | GL18317-PA | 1..179 | 1..128 | 185 | 29.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13358-PA | 241 | GA13358-PA | 1..230 | 1..215 | 304 | 39.5 | Plus |
Dpse\GA27472-PA | 189 | GA27472-PA | 1..147 | 1..128 | 220 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19192-PA | 196 | GM19192-PA | 1..196 | 25..220 | 929 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23788-PA | 220 | GD23788-PA | 1..220 | 1..220 | 1071 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16676-PA | 221 | GJ16676-PA | 1..215 | 1..218 | 363 | 45.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24559-PA | 226 | GK24559-PA | 1..223 | 1..217 | 297 | 40.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18539-PA | 219 | GE18539-PA | 1..219 | 1..220 | 938 | 86.4 | Plus |