Clone IP07019 Report

Search the DGRC for IP07019

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:70
Well:19
Vector:pOT2
Associated Gene/TranscriptCG14931-RB
Protein status:IP07019.pep: gold
Preliminary Size:591
Sequenced Size:877

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14931 2005-01-01 Successful iPCR screen
CG14931 2008-04-29 Release 5.5 accounting
CG14931 2008-08-15 Release 5.9 accounting
CG14931 2008-12-18 5.12 accounting

Clone Sequence Records

IP07019.complete Sequence

877 bp (877 high quality bases) assembled on 2006-09-27

GenBank Submission: BT029058

> IP07019.complete
TAACCACATAATATTAGTACTAAAGTTGTTGTTTTTGTCCCATTGAAAAT
GGAGTTACGCAGCCGAACAAACAGGAGATTAGTTGACTTCCTCAAAAGCG
CAGGCGTTTACGAGGAAGGCATGGATATTGAGGAAATGACCGAATTAGCA
AGTGTCGTGCAGCAATCAGCTAGTATCAGTCCCCAGGATGAGGATCTAGA
AAGGGCTCTGCACGAGAGCGAGTCTGATTTTTTGACTTCGCATCCCAGTG
CTTTGCACAACTCCACGATGATCATGTCGCCGCAAGTGTCCAGAAGAAAT
CCCTCAGACATGGACAGTCCACCGAGCGAGCCGATCCGTATAACTTTTCG
GGCTTTGGTGCACCGTGCCATGGACTGGAGTCCCACCACGGGCAATCAAA
TTCCCGATCGCAAGCGCATTGCTGCGGATCGCAATCAAAACGTCGAACTA
GTTGGCAAACGTTCCAGAGCAACGCCGGCTATCAGCATTGGCCAGGCACC
GGAGGATGAGCCGCACAATGCCGACGCCACACCCGTTTCCCCGGGCAACG
AATGCGACTCCGGCGTCAGCTGGGAGGAGATATCTTTGTCCAGCGCCAGC
GATAGCACCACTCTTCCTTCCATCGGCGAAATGCCCGATCGACATTTAAT
CAGCACCAGCAGCGTCGCCGTCTCGGATTTCTCAGATGCCAATGAAATCA
GCCAGGAATAGGCTATTTCCGCCCATGTCTTGTGGTTTATGTTTCCCAAT
CGAATGCAGTAGAGATTTTACAATGTTTATAGCCCACATATGTCTAAGAA
AGAGTACTCGAATAAGTTAACTATATGTCACATTAAAGGATTGAATTTAT
TGCATAAAAAAAAAAAAAAAAAAAAAA

IP07019.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14931-RB 1155 CG14931-RB 209..1065 1..857 4285 100 Plus
CG14931.a 917 CG14931.a 43..893 1..857 4170 99.2 Plus
CG14931.b 899 CG14931.b 258..899 214..855 3210 100 Plus
CG14931.b 899 CG14931.b 36..249 1..214 1070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11787469..11788110 214..855 3210 100 Plus
chr2L 23010047 chr2L 11787288..11787404 98..214 585 100 Plus
chr2L 23010047 chr2L 11787129..11787226 1..98 490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11788834..11789477 214..857 3220 100 Plus
2L 23513712 2L 11788653..11788769 98..214 585 100 Plus
2L 23513712 2L 11788494..11788591 1..98 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11788834..11789477 214..857 3220 100 Plus
2L 23513712 2L 11788653..11788769 98..214 585 100 Plus
2L 23513712 2L 11788494..11788591 1..98 490 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:25:33 has no hits.

IP07019.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:26:41 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11787129..11787225 1..97 100 -> Plus
chr2L 11787288..11787403 98..213 100 -> Plus
chr2L 11787469..11788110 214..855 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:16 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 1..663 49..711 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:23 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 1..663 49..711 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:10:13 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 1..663 49..711 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:08 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RA 1..591 121..711 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:27:08 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 1..663 49..711 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:25 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 34..888 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:23 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 34..888 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:10:13 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 58..912 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:09 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RA 1..591 121..711 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:27:08 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
CG14931-RB 58..912 1..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:41 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11788494..11788590 1..97 100 -> Plus
2L 11788653..11788768 98..213 100 -> Plus
2L 11788834..11789475 214..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:41 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11788494..11788590 1..97 100 -> Plus
2L 11788653..11788768 98..213 100 -> Plus
2L 11788834..11789475 214..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:26:41 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11788494..11788590 1..97 100 -> Plus
2L 11788653..11788768 98..213 100 -> Plus
2L 11788834..11789475 214..855 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:10:13 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11788494..11788590 1..97 100 -> Plus
arm_2L 11788653..11788768 98..213 100 -> Plus
arm_2L 11788834..11789475 214..855 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:13 Download gff for IP07019.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11788834..11789475 214..855 100   Plus
2L 11788494..11788590 1..97 100 -> Plus
2L 11788653..11788768 98..213 100 -> Plus

IP07019.hyp Sequence

Translation from 48 to 710

> IP07019.hyp
MELRSRTNRRLVDFLKSAGVYEEGMDIEEMTELASVVQQSASISPQDEDL
ERALHESESDFLTSHPSALHNSTMIMSPQVSRRNPSDMDSPPSEPIRITF
RALVHRAMDWSPTTGNQIPDRKRIAADRNQNVELVGKRSRATPAISIGQA
PEDEPHNADATPVSPGNECDSGVSWEEISLSSASDSTTLPSIGEMPDRHL
ISTSSVAVSDFSDANEISQE*

IP07019.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14931-PB 220 CG14931-PB 1..220 1..220 1117 100 Plus
CG14931-PC 223 CG14931-PC 1..223 1..220 1103 98.7 Plus

IP07019.pep Sequence

Translation from 48 to 710

> IP07019.pep
MELRSRTNRRLVDFLKSAGVYEEGMDIEEMTELASVVQQSASISPQDEDL
ERALHESESDFLTSHPSALHNSTMIMSPQVSRRNPSDMDSPPSEPIRITF
RALVHRAMDWSPTTGNQIPDRKRIAADRNQNVELVGKRSRATPAISIGQA
PEDEPHNADATPVSPGNECDSGVSWEEISLSSASDSTTLPSIGEMPDRHL
ISTSSVAVSDFSDANEISQE*

IP07019.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14570-PA 201 GF14570-PA 1..198 25..216 300 47.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23733-PA 221 GG23733-PA 1..221 1..220 911 82.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11371-PA 242 GH11371-PA 1..228 1..216 243 35.5 Plus
Dgri\GH23430-PA 242 GH23430-PA 1..228 1..216 241 35.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14931-PB 220 CG14931-PB 1..220 1..220 1117 100 Plus
CG14931-PC 223 CG14931-PC 1..223 1..220 1103 98.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18076-PA 214 GI18076-PA 1..213 1..218 334 41.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19316-PA 238 GL19316-PA 1..227 1..215 299 39.1 Plus
Dper\GL18317-PA 215 GL18317-PA 1..179 1..128 185 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13358-PA 241 GA13358-PA 1..230 1..215 304 39.5 Plus
Dpse\GA27472-PA 189 GA27472-PA 1..147 1..128 220 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19192-PA 196 GM19192-PA 1..196 25..220 929 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23788-PA 220 GD23788-PA 1..220 1..220 1071 93.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16676-PA 221 GJ16676-PA 1..215 1..218 363 45.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24559-PA 226 GK24559-PA 1..223 1..217 297 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18539-PA 219 GE18539-PA 1..219 1..220 938 86.4 Plus