Clone IP07030 Report

Search the DGRC for IP07030

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:70
Well:30
Vector:pOT2
Associated Gene/TranscriptCG15124-RA
Protein status:IP07030.pep: gold
Preliminary Size:576
Sequenced Size:719

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15124 2005-01-01 Successful iPCR screen
CG15124 2008-04-29 Release 5.5 accounting
CG15124 2008-08-15 Release 5.9 accounting
CG15124 2008-12-18 5.12 accounting

Clone Sequence Records

IP07030.complete Sequence

719 bp (719 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022645

> IP07030.complete
AAATAAGTTAAAATTTGATATCAATTAGAATGGATAACGACAATATGCTC
GACTTTACAGACTTAATCAGCTGCAAGGACTTACCGAACATAACTCTGCA
CAATATCCGTCCCATTTACAGTATAAAGGTTTTCATGTCCGAACCTAAAA
ACTCCAATGTCTCTATTGCTGAATTAATCAAACGCCAGGAAGTGTCTGCA
GAGCAATGTCGCAAGGCACTTAAAGTCATAAAGGACAGACTTCTTCTGAA
AATGGCAGCGTTGCAAGAGCTTAAGAAGTATCTGCTGGATTTGCATTCGG
AGATCAAAAAGCCCGGTGCAGGGACTCGTTTTGTGACCAATCAGGAGAAA
GTTAAATTGCATTTCCTAGACGAGACGGAAATCAGAGAAGTCGAATTGTC
TGACGCCGTAGAACGTTGCAATATAAAGCTGAGCTCGCTTTATTGCGAAA
TCCTGGCTTTGGACAGCGACATGGGCAGTGTCGCCTATTTGGAGAGGGTC
GCCCAGATCAACAAAGACTTTATCATGGATTGGCATAAGACTCAGAGGCA
GAATAAGACAAGCAACATCCATTGTTCCGGCCAAGGCGTCAAAAAGACTT
TTTAATTTGGACTGTTTTAAACTTTACATGTTTCACTCATATGCAATTAT
TATCGCACTATTCTGGAAAATAAATATTTATCGCGAAAGCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

IP07030.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15124-RA 690 CG15124-RA 1..690 1..690 3450 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15530239..15530928 1..690 3405 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19643009..19643708 1..700 3470 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19644208..19644907 1..700 3470 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 19:21:50 has no hits.

IP07030.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:22:28 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15530239..15530928 1..690 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:17 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:40 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:48 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:06 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:28:49 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:12:01 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:39 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 63..752 1..690 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:48 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 63..752 1..690 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:06 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 1..576 30..605 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:28:49 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
CG15124-RA 63..752 1..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:28 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19643009..19643698 1..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:28 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19643009..19643698 1..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:22:28 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19643009..19643698 1..690 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:48 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15530514..15531203 1..690 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:39 Download gff for IP07030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19644208..19644897 1..690 100   Plus

IP07030.pep Sequence

Translation from 29 to 604

> IP07030.pep
MDNDNMLDFTDLISCKDLPNITLHNIRPIYSIKVFMSEPKNSNVSIAELI
KRQEVSAEQCRKALKVIKDRLLLKMAALQELKKYLLDLHSEIKKPGAGTR
FVTNQEKVKLHFLDETEIREVELSDAVERCNIKLSSLYCEILALDSDMGS
VAYLERVAQINKDFIMDWHKTQRQNKTSNIHCSGQGVKKTF*

IP07030.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11729-PA 194 GF11729-PA 10..175 9..173 277 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21989-PA 192 GG21989-PA 1..192 1..191 640 64.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23009-PA 181 GH23009-PA 20..170 20..176 304 40.8 Plus
Dgri\GH23713-PA 181 GH23713-PA 20..170 20..176 299 40.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15124-PA 191 CG15124-PA 1..191 1..191 975 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21076-PA 184 GI21076-PA 6..173 7..176 315 41.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10352-PA 394 GL10352-PA 1..173 1..172 316 37 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13512-PA 395 GA13512-PA 1..173 1..172 316 37 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21976-PA 191 GM21976-PA 1..190 1..190 864 85.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11470-PA 191 GD11470-PA 1..190 1..190 799 82.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20922-PA 190 GJ20922-PA 6..176 7..177 325 42.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19101-PA 190 GK19101-PA 10..180 11..179 261 33.9 Plus
Dwil\GK15882-PA 185 GK15882-PA 18..180 16..179 231 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12069-PA 192 GE12069-PA 1..191 1..190 669 67 Plus

IP07030.hyp Sequence

Translation from 29 to 604

> IP07030.hyp
MDNDNMLDFTDLISCKDLPNITLHNIRPIYSIKVFMSEPKNSNVSIAELI
KRQEVSAEQCRKALKVIKDRLLLKMAALQELKKYLLDLHSEIKKPGAGTR
FVTNQEKVKLHFLDETEIREVELSDAVERCNIKLSSLYCEILALDSDMGS
VAYLERVAQINKDFIMDWHKTQRQNKTSNIHCSGQGVKKTF*

IP07030.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15124-PA 191 CG15124-PA 1..191 1..191 975 100 Plus