BDGP Sequence Production Resources |
Search the DGRC for IP07030
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 70 |
Well: | 30 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15124-RA |
Protein status: | IP07030.pep: gold |
Preliminary Size: | 576 |
Sequenced Size: | 719 |
Gene | Date | Evidence |
---|---|---|
CG15124 | 2005-01-01 | Successful iPCR screen |
CG15124 | 2008-04-29 | Release 5.5 accounting |
CG15124 | 2008-08-15 | Release 5.9 accounting |
CG15124 | 2008-12-18 | 5.12 accounting |
719 bp (719 high quality bases) assembled on 2005-01-13
GenBank Submission: BT022645
> IP07030.complete AAATAAGTTAAAATTTGATATCAATTAGAATGGATAACGACAATATGCTC GACTTTACAGACTTAATCAGCTGCAAGGACTTACCGAACATAACTCTGCA CAATATCCGTCCCATTTACAGTATAAAGGTTTTCATGTCCGAACCTAAAA ACTCCAATGTCTCTATTGCTGAATTAATCAAACGCCAGGAAGTGTCTGCA GAGCAATGTCGCAAGGCACTTAAAGTCATAAAGGACAGACTTCTTCTGAA AATGGCAGCGTTGCAAGAGCTTAAGAAGTATCTGCTGGATTTGCATTCGG AGATCAAAAAGCCCGGTGCAGGGACTCGTTTTGTGACCAATCAGGAGAAA GTTAAATTGCATTTCCTAGACGAGACGGAAATCAGAGAAGTCGAATTGTC TGACGCCGTAGAACGTTGCAATATAAAGCTGAGCTCGCTTTATTGCGAAA TCCTGGCTTTGGACAGCGACATGGGCAGTGTCGCCTATTTGGAGAGGGTC GCCCAGATCAACAAAGACTTTATCATGGATTGGCATAAGACTCAGAGGCA GAATAAGACAAGCAACATCCATTGTTCCGGCCAAGGCGTCAAAAAGACTT TTTAATTTGGACTGTTTTAAACTTTACATGTTTCACTCATATGCAATTAT TATCGCACTATTCTGGAAAATAAATATTTATCGCGAAAGCAAAAAAAAAA AAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15124-RA | 690 | CG15124-RA | 1..690 | 1..690 | 3450 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 15530239..15530928 | 1..690 | 3405 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 19643009..19643708 | 1..700 | 3470 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 19644208..19644907 | 1..700 | 3470 | 99.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 15530239..15530928 | 1..690 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 63..752 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 63..752 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 1..576 | 30..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15124-RA | 63..752 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19643009..19643698 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19643009..19643698 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19643009..19643698 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 15530514..15531203 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19644208..19644897 | 1..690 | 100 | Plus |
Translation from 29 to 604
> IP07030.pep MDNDNMLDFTDLISCKDLPNITLHNIRPIYSIKVFMSEPKNSNVSIAELI KRQEVSAEQCRKALKVIKDRLLLKMAALQELKKYLLDLHSEIKKPGAGTR FVTNQEKVKLHFLDETEIREVELSDAVERCNIKLSSLYCEILALDSDMGS VAYLERVAQINKDFIMDWHKTQRQNKTSNIHCSGQGVKKTF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11729-PA | 194 | GF11729-PA | 10..175 | 9..173 | 277 | 33.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21989-PA | 192 | GG21989-PA | 1..192 | 1..191 | 640 | 64.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23009-PA | 181 | GH23009-PA | 20..170 | 20..176 | 304 | 40.8 | Plus |
Dgri\GH23713-PA | 181 | GH23713-PA | 20..170 | 20..176 | 299 | 40.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15124-PA | 191 | CG15124-PA | 1..191 | 1..191 | 975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21076-PA | 184 | GI21076-PA | 6..173 | 7..176 | 315 | 41.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10352-PA | 394 | GL10352-PA | 1..173 | 1..172 | 316 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13512-PA | 395 | GA13512-PA | 1..173 | 1..172 | 316 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21976-PA | 191 | GM21976-PA | 1..190 | 1..190 | 864 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11470-PA | 191 | GD11470-PA | 1..190 | 1..190 | 799 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20922-PA | 190 | GJ20922-PA | 6..176 | 7..177 | 325 | 42.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19101-PA | 190 | GK19101-PA | 10..180 | 11..179 | 261 | 33.9 | Plus |
Dwil\GK15882-PA | 185 | GK15882-PA | 18..180 | 16..179 | 231 | 31.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12069-PA | 192 | GE12069-PA | 1..191 | 1..190 | 669 | 67 | Plus |
Translation from 29 to 604
> IP07030.hyp MDNDNMLDFTDLISCKDLPNITLHNIRPIYSIKVFMSEPKNSNVSIAELI KRQEVSAEQCRKALKVIKDRLLLKMAALQELKKYLLDLHSEIKKPGAGTR FVTNQEKVKLHFLDETEIREVELSDAVERCNIKLSSLYCEILALDSDMGS VAYLERVAQINKDFIMDWHKTQRQNKTSNIHCSGQGVKKTF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15124-PA | 191 | CG15124-PA | 1..191 | 1..191 | 975 | 100 | Plus |