Clone IP07033 Report

Search the DGRC for IP07033

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:70
Well:33
Vector:pOT2
Associated Gene/TranscriptCG15147-RA
Protein status:IP07033.pep: gold
Preliminary Size:599
Sequenced Size:603

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15147 2005-01-01 Successful iPCR screen
CG15147 2008-04-29 Release 5.5 accounting
CG15147 2008-08-15 Release 5.9 accounting
CG15147 2008-12-18 5.12 accounting

Clone Sequence Records

IP07033.complete Sequence

603 bp (603 high quality bases) assembled on 2006-09-22

GenBank Submission: BT029059

> IP07033.complete
CTCGACCGGGATTGTCTCCCACATCCTGCCATGCCTGCTGCTCGCTGAAG
TCCGTGGTCTGTGGTCCGCCCAAGATTTCCACCTGTTTACCTGGTCCATC
TGCCTCCCAGAGATGCCCGACAAAAGGCCACTGGATCCACTCCAGCCGGT
GCTCTACATTGACCACTGCCGTTATCGTCAAACTTATCGCAAGCGAGCCC
TGCACCTCCATTCTTCGCTGGCGGAGGCTCTGAGGGCCATTCAGCCAAGG
GTTAAGCTCCAGCTAAGGATCAACGACAAAGGCCCGCCCGAAGATGGATC
CTTTGAGGTTGCTATTGCTCCGCAACCAACCGATGATTCCACGGCCCGTC
AAAGTGTATGGACTGGACTAAGGCGGATGCCCAGTGCATCGAAGGTTCCC
CATGTGGACGACATTCTCACCCCAGTTTGTTTCGCCCTCAAACTGAGGGA
TCCGCACAAGGAATCACATCGGCGGATGCTAACCAATTTGCGGCACAACG
AAGGCAGTCGACCAAGGACGAGGACTATAAAAAATGTGTTAAATAATACC
TAGTAAATATTACAATAATAAACCAACACACTTGCAAAAAAAAAAAAAAA
AAA

IP07033.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15147-RA 600 CG15147-RA 15..600 1..585 2890 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17624399..17624984 585..1 2880 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17625744..17626331 587..1 2890 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17625744..17626331 587..1 2900 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 21:49:29 has no hits.

IP07033.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:50:26 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17624399..17624984 1..585 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:19 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 1..441 113..553 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:20 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 1..441 113..553 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:59:38 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 1..441 113..553 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:25 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 1..441 113..553 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:04:01 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 1..441 113..553 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:50 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 15..599 1..584 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:20 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 16..601 1..585 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:59:38 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 16..601 1..585 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:25 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 15..599 1..584 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:04:01 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
CG15147-RA 51..636 1..585 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:26 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17625746..17626331 1..585 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:26 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17625746..17626331 1..585 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:50:26 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17625746..17626331 1..585 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:59:38 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17625746..17626331 1..585 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:02 Download gff for IP07033.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17625746..17626331 1..585 99   Minus

IP07033.hyp Sequence

Translation from 2 to 552

> IP07033.hyp
RPGLSPTSCHACCSLKSVVCGPPKISTCLPVSICLPEMPDKRPLDPLQPV
LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGS
FEVAIAPQPTDDSTARQSVWTGLRRMPSASKVPHVDDILTPVCFALKLRD
PHKESHRRMLTNLRHNEGSRPRTRTIKNVLNNT*

IP07033.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG15147-PA 146 CG15147-PA 1..146 38..183 773 100 Plus
BthD-PA 249 CG11177-PA 22..127 44..154 163 36.6 Plus

IP07033.pep Sequence

Translation from 112 to 552

> IP07033.pep
MPDKRPLDPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQ
LRINDKGPPEDGSFEVAIAPQPTDDSTARQSVWTGLRRMPSASKVPHVDD
ILTPVCFALKLRDPHKESHRRMLTNLRHNEGSRPRTRTIKNVLNNT*

IP07033.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15090-PA 139 GF15090-PA 1..135 1..135 590 82.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21730-PA 146 GG21730-PA 1..146 1..146 722 93.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10147-PA 146 GH10147-PA 9..132 6..131 349 53.2 Plus
Dgri\GH12971-PA 165 GH12971-PA 20..93 3..101 143 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15147-PA 146 CG15147-PA 1..146 1..146 773 100 Plus
BthD-PA 249 CG11177-PA 22..127 7..117 163 36.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22323-PA 147 GI22323-PA 12..135 6..131 353 54.8 Plus
Dmoj\GI15453-PA 118 GI15453-PA 14..74 49..109 151 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13528-PA 138 GA13528-PA 1..138 1..133 443 65.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17112-PA 146 GM17112-PA 1..144 1..144 731 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21854-PA 146 GD21854-PA 1..146 1..146 740 97.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20231-PA 144 GJ20231-PA 1..132 1..131 350 51.5 Plus
Dvir\GJ19168-PA 140 GJ19168-PA 18..90 37..109 158 37 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25075-PA 182 GK25075-PA 25..123 7..109 214 42.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13119-PA 146 GE13119-PA 1..146 1..146 712 91.8 Plus