BDGP Sequence Production Resources |
Search the DGRC for IP07033
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 70 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15147-RA |
Protein status: | IP07033.pep: gold |
Preliminary Size: | 599 |
Sequenced Size: | 603 |
Gene | Date | Evidence |
---|---|---|
CG15147 | 2005-01-01 | Successful iPCR screen |
CG15147 | 2008-04-29 | Release 5.5 accounting |
CG15147 | 2008-08-15 | Release 5.9 accounting |
CG15147 | 2008-12-18 | 5.12 accounting |
603 bp (603 high quality bases) assembled on 2006-09-22
GenBank Submission: BT029059
> IP07033.complete CTCGACCGGGATTGTCTCCCACATCCTGCCATGCCTGCTGCTCGCTGAAG TCCGTGGTCTGTGGTCCGCCCAAGATTTCCACCTGTTTACCTGGTCCATC TGCCTCCCAGAGATGCCCGACAAAAGGCCACTGGATCCACTCCAGCCGGT GCTCTACATTGACCACTGCCGTTATCGTCAAACTTATCGCAAGCGAGCCC TGCACCTCCATTCTTCGCTGGCGGAGGCTCTGAGGGCCATTCAGCCAAGG GTTAAGCTCCAGCTAAGGATCAACGACAAAGGCCCGCCCGAAGATGGATC CTTTGAGGTTGCTATTGCTCCGCAACCAACCGATGATTCCACGGCCCGTC AAAGTGTATGGACTGGACTAAGGCGGATGCCCAGTGCATCGAAGGTTCCC CATGTGGACGACATTCTCACCCCAGTTTGTTTCGCCCTCAAACTGAGGGA TCCGCACAAGGAATCACATCGGCGGATGCTAACCAATTTGCGGCACAACG AAGGCAGTCGACCAAGGACGAGGACTATAAAAAATGTGTTAAATAATACC TAGTAAATATTACAATAATAAACCAACACACTTGCAAAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15147-RA | 600 | CG15147-RA | 15..600 | 1..585 | 2890 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 17624399..17624984 | 585..1 | 2880 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 17625744..17626331 | 587..1 | 2890 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 17625744..17626331 | 587..1 | 2900 | 99.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 17624399..17624984 | 1..585 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 1..441 | 113..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 1..441 | 113..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 1..441 | 113..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 1..441 | 113..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 1..441 | 113..553 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 15..599 | 1..584 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 16..601 | 1..585 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 16..601 | 1..585 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 15..599 | 1..584 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15147-RA | 51..636 | 1..585 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17625746..17626331 | 1..585 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17625746..17626331 | 1..585 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17625746..17626331 | 1..585 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 17625746..17626331 | 1..585 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 17625746..17626331 | 1..585 | 99 | Minus |
Translation from 2 to 552
> IP07033.hyp RPGLSPTSCHACCSLKSVVCGPPKISTCLPVSICLPEMPDKRPLDPLQPV LYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQLRINDKGPPEDGS FEVAIAPQPTDDSTARQSVWTGLRRMPSASKVPHVDDILTPVCFALKLRD PHKESHRRMLTNLRHNEGSRPRTRTIKNVLNNT*
Translation from 112 to 552
> IP07033.pep MPDKRPLDPLQPVLYIDHCRYRQTYRKRALHLHSSLAEALRAIQPRVKLQ LRINDKGPPEDGSFEVAIAPQPTDDSTARQSVWTGLRRMPSASKVPHVDD ILTPVCFALKLRDPHKESHRRMLTNLRHNEGSRPRTRTIKNVLNNT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15090-PA | 139 | GF15090-PA | 1..135 | 1..135 | 590 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21730-PA | 146 | GG21730-PA | 1..146 | 1..146 | 722 | 93.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10147-PA | 146 | GH10147-PA | 9..132 | 6..131 | 349 | 53.2 | Plus |
Dgri\GH12971-PA | 165 | GH12971-PA | 20..93 | 3..101 | 143 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15147-PA | 146 | CG15147-PA | 1..146 | 1..146 | 773 | 100 | Plus |
BthD-PA | 249 | CG11177-PA | 22..127 | 7..117 | 163 | 36.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22323-PA | 147 | GI22323-PA | 12..135 | 6..131 | 353 | 54.8 | Plus |
Dmoj\GI15453-PA | 118 | GI15453-PA | 14..74 | 49..109 | 151 | 42.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13528-PA | 138 | GA13528-PA | 1..138 | 1..133 | 443 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17112-PA | 146 | GM17112-PA | 1..144 | 1..144 | 731 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21854-PA | 146 | GD21854-PA | 1..146 | 1..146 | 740 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20231-PA | 144 | GJ20231-PA | 1..132 | 1..131 | 350 | 51.5 | Plus |
Dvir\GJ19168-PA | 140 | GJ19168-PA | 18..90 | 37..109 | 158 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25075-PA | 182 | GK25075-PA | 25..123 | 7..109 | 214 | 42.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13119-PA | 146 | GE13119-PA | 1..146 | 1..146 | 712 | 91.8 | Plus |