Clone IP07051 Report

Search the DGRC for IP07051

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:70
Well:51
Vector:pOT2
Associated Gene/TranscriptCG15642-RA
Protein status:IP07051.pep: gold
Preliminary Size:552
Sequenced Size:1279

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15642 2005-01-01 Successful iPCR screen
CG15642 2008-04-29 Release 5.5 accounting
CG15642 2008-08-15 Release 5.9 accounting
CG15642 2008-12-18 5.12 accounting

Clone Sequence Records

IP07051.complete Sequence

1279 bp (1279 high quality bases) assembled on 2006-03-22

GenBank Submission: BT025001

> IP07051.complete
CCACTTGCCACTGAACTGAAGTGCAGTGCCTAGAGAGTGCTTGGTGAAAA
TCCAATCGAAATGGCGTACTCGGTGACGCCGCATCGGGCCAACCTGGTGC
TGCAAATGCTGCTGCAGGCCAACACGTATGTGTCCATGGTGTGGGCCATG
AGCTACATGATCCACATGCTCATACGCCTGCATCATTTGTGGAACCTGGA
GGGCCTGTCCATGCTGGTGGCCTACGTTTTGGCGGTGTCCGCTGAATCCG
TACGCCTATACGCCGGCTACTCGGTGAACCTGTGCTCTGGCGCCACCGCC
ATGTGGATGCTGCTCACCGTGACACCATGCATCCTGCTGCCCGCCATGGT
CTTTCTTCGCCTCTCAGCTGCCGGACGCAGTTTGTGGCTACGCATCATCA
CGAACGCCGTGTTCGCGCTAATAGTTCTCGAGGTGATCGTGTCTCTGGTG
CACTTTGTTATCTGCAAGCCAGGCTGTAAGCTGCCGCTGCCGCTAGAAGG
GAACGAGCAGCTGCCGGAGGAGGATGAGGAGGAGCAGCAGCAATCCGCCA
GTGTGGGCACACCCACGACCAATGAGCAAAAGCGACGCGTGCGACGCTAC
CCGGAATCGTAGTGATGAGCTGTCAGCAGGTGGTTTATAAGTAAGGCTCT
GCGTTTTACTTGGACATGGGCATAAATAATAAAGTAGGATAAGCTATTTA
AGCTAAGCTAGGCTAGGCTAGGCTAAGGAACGATCACACCTTTCGTGCAT
CGTCCAAGTTGTGCGCCTTCAGCAGGGCGTCGATCGAGTCCAGATGGGCG
CGCATACGCGGCAGGAAGCTGGTCAGCACCTCGATGTTCTCCGCCTGGGC
GACACCCTGGCCCAGCAGTTGGCTGCGCGTGGGCACCCAACTGTAGATGA
TCTGCAAGCGAGGGAATGAGCGCCCAATTAGCGAAGGAAGTGAGAGATAC
CCGCCCGATGCACCCACCTTGATTGTGCTCTGGACGATGAAGCCGTGGTA
GGGCTTCAATGTGCGTTCGTACGCGTCCTGCAGATGCTGCTTAAGTGCCT
CCTTGGCCTGGGCATCGTTGTAGATGTTCTCGAGGAAGGTGCATATGAGC
TGCAGGCCGCGCTTCAGCCAGAGCAGCGCGTTGGCCGCAAAGTCGTCCAC
GTTCACGTTCAGCACGATCAGATCCTCCAGATACTGGTACTTGACCACAT
CCGCTCCGTAGGCTTTCGTCAGTTTCTGAAACGGCAATAAACGGCAATGA
AAACGAATGTAAAAAAAAAAAAAAAAAAA

IP07051.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15642-RA 1419 CG15642-RA 159..1419 1..1260 6250 99.8 Plus
CG6299-RA 1013 CG6299-RA 742..1013 903..632 1360 100 Minus
CG6294-RA 2558 CG6294-RA 2287..2558 903..632 1360 100 Minus
CG6299-RA 1013 CG6299-RA 486..743 1225..968 1275 99.6 Minus
CG6294-RA 2558 CG6294-RA 2031..2288 1225..968 1275 99.6 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15356127..15357210 1260..178 5250 99.2 Minus
chrX 22417052 chrX 15357289..15357465 177..1 825 97.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15466183..15467267 1261..178 5360 99.8 Minus
X 23542271 X 15467353..15467529 177..1 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15474281..15475365 1261..178 5370 99.8 Minus
X 23527363 X 15475451..15475627 177..1 885 100 Minus
Blast to na_te.dros performed 2019-03-15 16:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6777..6887 479..586 115 58.6 Plus

IP07051.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:59:21 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15356127..15357210 178..1260 96 <- Minus
chrX 15357289..15357465 1..177 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:22 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..552 61..612 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:02 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..552 61..612 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:11 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..552 61..612 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:51:59 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..552 61..612 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:37 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..552 61..612 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:56:42 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..552 61..612 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:02 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..1261 1..1260 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:11 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..1261 1..1260 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:51:59 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..552 61..612 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:37 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
CG15642-RA 1..1261 1..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:21 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
X 15466184..15467267 178..1260 99 <- Minus
X 15467353..15467529 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:21 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
X 15466184..15467267 178..1260 99 <- Minus
X 15467353..15467529 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:59:21 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
X 15466184..15467267 178..1260 99 <- Minus
X 15467353..15467529 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:11 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15361386..15361562 1..177 100   Minus
arm_X 15360217..15361300 178..1260 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:26:51 Download gff for IP07051.complete
Subject Subject Range Query Range Percent Splice Strand
X 15474282..15475365 178..1260 99 <- Minus
X 15475451..15475627 1..177 100   Minus

IP07051.pep Sequence

Translation from 60 to 611

> IP07051.pep
MAYSVTPHRANLVLQMLLQANTYVSMVWAMSYMIHMLIRLHHLWNLEGLS
MLVAYVLAVSAESVRLYAGYSVNLCSGATAMWMLLTVTPCILLPAMVFLR
LSAAGRSLWLRIITNAVFALIVLEVIVSLVHFVICKPGCKLPLPLEGNEQ
LPEEDEEEQQQSASVGTPTTNEQKRRVRRYPES*

IP07051.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21905-PA 194 GF21905-PA 1..193 1..183 617 64.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19399-PA 183 GG19399-PA 1..182 1..183 804 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12440-PA 168 GH12440-PA 17..153 4..140 373 56.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG15642-PB 183 CG15642-PB 1..183 1..183 935 100 Plus
CG15642-PA 183 CG15642-PA 1..183 1..183 935 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21793-PA 137 GI21793-PA 1..115 16..130 331 54.8 Plus
Dmoj\GI21619-PA 164 GI21619-PA 1..126 1..129 145 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13308-PA 166 GL13308-PA 2..166 3..155 272 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22831-PA 166 GA22831-PA 2..164 3..178 318 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19536-PA 193 GM19536-PA 1..192 1..183 780 87 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24500-PA 192 GD24500-PA 1..191 1..183 884 92.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16965-PA 169 GJ16965-PA 24..148 9..133 335 58.4 Plus
Dvir\GJ16558-PA 169 GJ16558-PA 1..128 1..128 178 36.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25478-PA 203 GK25478-PA 35..172 3..140 433 55.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16045-PA 180 GE16045-PA 1..179 1..183 768 87.4 Plus

IP07051.hyp Sequence

Translation from 60 to 611

> IP07051.hyp
MAYSVTPHRANLVLQMLLQANTYVSMVWAMSYMIHMLIRLHHLWNLEGLS
MLVAYVLAVSAESVRLYAGYSVNLCSGATAMWMLLTVTPCILLPAMVFLR
LSAAGRSLWLRIITNAVFALIVLEVIVSLVHFVICKPGCKLPLPLEGNEQ
LPEEDEEEQQQSASVGTPTTNEQKRRVRRYPES*

IP07051.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15642-PB 183 CG15642-PB 1..183 1..183 935 100 Plus
CG15642-PA 183 CG15642-PA 1..183 1..183 935 100 Plus