BDGP Sequence Production Resources |
Search the DGRC for IP07063
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 70 |
Well: | 63 |
Vector: | pOT2 |
Associated Gene/Transcript | CG17261-RA |
Protein status: | IP07063.pep: gold |
Preliminary Size: | 603 |
Sequenced Size: | 658 |
Gene | Date | Evidence |
---|---|---|
CG17261-RA | 2009-01-21 | est gleaning |
658 bp assembled on 2009-04-22
GenBank Submission: BT082060.1
> IP07063.complete AGGACCAACACAACAAAATCATTCTACTCAAGCTATTGAATCTATTTGGA TCGGCACACAAACATTCATTTTCTGAGACTACAAGTAGTAAACCAAAATT TATAATGGATAAACATAAACCTACGTTGCTGCCGTATATTATGGACATGC TAAGTCGCGAGACGCAAATGTGCTCTTCTGTGGACGACGTGGTTAAACAC ATCAAGGACGTTATGCTCGAGGAGCACGTCAGAGCCTTCGGGAGCCTCAA GCGTGCGGTGGAGTTTGCCCTGGAGTTGGGCGTCAACATGGGCATCCTCT CGATGACCAAGACGGTCCGCATGCCCATCAGGTACCGCAGAAGTAAATCC AAGACTAAGGTGCCTGTCAGGAACAGGATCCCTCTCCGCTTGGGACGCCA GCTGACCAAGCAGCGGATGGCGACGACCACGGCAACCAAGTTGGCGGCCA AGAAGCGGTCAGGCGGACGCCTAAAAAAGCCCAAGAAGACTCCTGGGGCA GCGCCAAAGAAGCAAAACTAGAAGAGAAACCATGGCTATGAAATCTGTTC TGTCCAATAAATAATACAATTGCGAATGGCTTGCAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17261.b | 1355 | CG17261.b | 770..1355 | 1..586 | 2930 | 100 | Plus |
CG17261-RA | 734 | CG17261-RA | 113..698 | 1..586 | 2930 | 100 | Plus |
CG17261.a | 635 | CG17261.a | 221..635 | 172..586 | 2075 | 100 | Plus |
CG17261.a | 635 | CG17261.a | 18..189 | 1..172 | 860 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 3042581..3042751 | 1..171 | 100 | -> | Plus |
chr2L | 3042829..3043241 | 172..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 1..417 | 105..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 1..417 | 105..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 1..417 | 105..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 1..417 | 105..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 18..601 | 1..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 15..598 | 1..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 15..598 | 1..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17261-RA | 15..598 | 1..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3042933..3043103 | 1..171 | 100 | -> | Plus |
2L | 3043181..3043593 | 172..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3042933..3043103 | 1..171 | 100 | -> | Plus |
2L | 3043181..3043593 | 172..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3042933..3043103 | 1..171 | 100 | -> | Plus |
2L | 3043181..3043593 | 172..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 3042933..3043103 | 1..171 | 100 | -> | Plus |
arm_2L | 3043181..3043593 | 172..584 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 3043181..3043593 | 172..584 | 100 | Plus | |
2L | 3042933..3043103 | 1..171 | 100 | -> | Plus |
Translation from 2 to 520
> IP07063.pep DQHNKIILLKLLNLFGSAHKHSFSETTSSKPKFIMDKHKPTLLPYIMDML SRETQMCSSVDDVVKHIKDVMLEEHVRAFGSLKRAVEFALELGVNMGILS MTKTVRMPIRYRRSKSKTKVPVRNRIPLRLGRQLTKQRMATTTATKLAAK KRSGGRLKKPKKTPGAAPKKQN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14399-PA | 115 | GF14399-PA | 1..113 | 35..145 | 226 | 42.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24916-PA | 125 | GG24916-PA | 1..104 | 47..149 | 353 | 65.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17252-PA | 177 | GH17252-PA | 1..79 | 35..112 | 182 | 38 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17261-PB | 138 | CG17261-PB | 1..138 | 35..172 | 695 | 100 | Plus |
CG17261-PA | 138 | CG17261-PA | 1..138 | 35..172 | 695 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10498-PA | 164 | GI10498-PA | 1..79 | 35..112 | 169 | 45.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18550-PA | 156 | GL18550-PA | 5..88 | 41..127 | 192 | 42.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14422-PA | 175 | GA14422-PA | 5..88 | 41..127 | 192 | 42.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18392-PA | 125 | GM18392-PA | 1..125 | 47..170 | 502 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23204-PA | 125 | GD23204-PA | 1..125 | 47..170 | 496 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21714-PA | 179 | GJ21714-PA | 1..138 | 35..163 | 183 | 38.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15567-PA | 147 | GK15567-PA | 4..104 | 39..139 | 207 | 41.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18208-PA | 124 | GE18208-PA | 1..124 | 47..172 | 331 | 57.5 | Plus |
Translation from 2 to 520
> IP07063.hyp DQHNKIILLKLLNLFGSAHKHSFSETTSSKPKFIMDKHKPTLLPYIMDML SRETQMCSSVDDVVKHIKDVMLEEHVRAFGSLKRAVEFALELGVNMGILS MTKTVRMPIRYRRSKSKTKVPVRNRIPLRLGRQLTKQRMATTTATKLAAK KRSGGRLKKPKKTPGAAPKKQN*