Clone IP07063 Report

Search the DGRC for IP07063

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:70
Well:63
Vector:pOT2
Associated Gene/TranscriptCG17261-RA
Protein status:IP07063.pep: gold
Preliminary Size:603
Sequenced Size:658

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17261-RA 2009-01-21 est gleaning

Clone Sequence Records

IP07063.complete Sequence

658 bp assembled on 2009-04-22

GenBank Submission: BT082060.1

> IP07063.complete
AGGACCAACACAACAAAATCATTCTACTCAAGCTATTGAATCTATTTGGA
TCGGCACACAAACATTCATTTTCTGAGACTACAAGTAGTAAACCAAAATT
TATAATGGATAAACATAAACCTACGTTGCTGCCGTATATTATGGACATGC
TAAGTCGCGAGACGCAAATGTGCTCTTCTGTGGACGACGTGGTTAAACAC
ATCAAGGACGTTATGCTCGAGGAGCACGTCAGAGCCTTCGGGAGCCTCAA
GCGTGCGGTGGAGTTTGCCCTGGAGTTGGGCGTCAACATGGGCATCCTCT
CGATGACCAAGACGGTCCGCATGCCCATCAGGTACCGCAGAAGTAAATCC
AAGACTAAGGTGCCTGTCAGGAACAGGATCCCTCTCCGCTTGGGACGCCA
GCTGACCAAGCAGCGGATGGCGACGACCACGGCAACCAAGTTGGCGGCCA
AGAAGCGGTCAGGCGGACGCCTAAAAAAGCCCAAGAAGACTCCTGGGGCA
GCGCCAAAGAAGCAAAACTAGAAGAGAAACCATGGCTATGAAATCTGTTC
TGTCCAATAAATAATACAATTGCGAATGGCTTGCAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

IP07063.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG17261.b 1355 CG17261.b 770..1355 1..586 2930 100 Plus
CG17261-RA 734 CG17261-RA 113..698 1..586 2930 100 Plus
CG17261.a 635 CG17261.a 221..635 172..586 2075 100 Plus
CG17261.a 635 CG17261.a 18..189 1..172 860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3042829..3043241 172..584 2065 100 Plus
chr2L 23010047 chr2L 3042581..3042752 1..172 860 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3043181..3043595 172..586 2075 100 Plus
2L 23513712 2L 3042933..3043104 1..172 860 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3043181..3043595 172..586 2075 100 Plus
2L 23513712 2L 3042933..3043104 1..172 860 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:51:17 has no hits.

IP07063.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:52:16 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3042581..3042751 1..171 100 -> Plus
chr2L 3042829..3043241 172..584 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:53 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 1..417 105..521 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:45:46 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 1..417 105..521 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:46:18 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 1..417 105..521 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:10 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 1..417 105..521 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-22 13:44:50 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 18..601 1..584 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:45:46 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 15..598 1..584 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:46:18 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 15..598 1..584 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:10 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17261-RA 15..598 1..584 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:16 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3042933..3043103 1..171 100 -> Plus
2L 3043181..3043593 172..584 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:16 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3042933..3043103 1..171 100 -> Plus
2L 3043181..3043593 172..584 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:16 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3042933..3043103 1..171 100 -> Plus
2L 3043181..3043593 172..584 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:46:18 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3042933..3043103 1..171 100 -> Plus
arm_2L 3043181..3043593 172..584 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:31:31 Download gff for IP07063.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3043181..3043593 172..584 100   Plus
2L 3042933..3043103 1..171 100 -> Plus

IP07063.pep Sequence

Translation from 2 to 520

> IP07063.pep
DQHNKIILLKLLNLFGSAHKHSFSETTSSKPKFIMDKHKPTLLPYIMDML
SRETQMCSSVDDVVKHIKDVMLEEHVRAFGSLKRAVEFALELGVNMGILS
MTKTVRMPIRYRRSKSKTKVPVRNRIPLRLGRQLTKQRMATTTATKLAAK
KRSGGRLKKPKKTPGAAPKKQN*

IP07063.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14399-PA 115 GF14399-PA 1..113 35..145 226 42.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24916-PA 125 GG24916-PA 1..104 47..149 353 65.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17252-PA 177 GH17252-PA 1..79 35..112 182 38 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17261-PB 138 CG17261-PB 1..138 35..172 695 100 Plus
CG17261-PA 138 CG17261-PA 1..138 35..172 695 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10498-PA 164 GI10498-PA 1..79 35..112 169 45.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18550-PA 156 GL18550-PA 5..88 41..127 192 42.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14422-PA 175 GA14422-PA 5..88 41..127 192 42.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18392-PA 125 GM18392-PA 1..125 47..170 502 80 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23204-PA 125 GD23204-PA 1..125 47..170 496 78.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21714-PA 179 GJ21714-PA 1..138 35..163 183 38.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15567-PA 147 GK15567-PA 4..104 39..139 207 41.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18208-PA 124 GE18208-PA 1..124 47..172 331 57.5 Plus

IP07063.hyp Sequence

Translation from 2 to 520

> IP07063.hyp
DQHNKIILLKLLNLFGSAHKHSFSETTSSKPKFIMDKHKPTLLPYIMDML
SRETQMCSSVDDVVKHIKDVMLEEHVRAFGSLKRAVEFALELGVNMGILS
MTKTVRMPIRYRRSKSKTKVPVRNRIPLRLGRQLTKQRMATTTATKLAAK
KRSGGRLKKPKKTPGAAPKKQN*

IP07063.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG17261-PB 138 CG17261-PB 1..138 35..172 695 100 Plus
CG17261-PA 138 CG17261-PA 1..138 35..172 695 100 Plus