Clone IP07107 Report

Search the DGRC for IP07107

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:7
Vector:pOT2
Associated Gene/Transcriptglob3-RA
Protein status:IP07107.pep: gold
Preliminary Size:588
Sequenced Size:1137

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14675 2005-01-01 Successful iPCR screen
CG14675 2008-04-29 Release 5.5 accounting
CG14675 2008-08-15 Release 5.9 accounting
glob3 2008-12-18 5.12 accounting

Clone Sequence Records

IP07107.complete Sequence

1137 bp (1137 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022666

> IP07107.complete
AATCTACACATTTTTTATGTTTTTTTCATTGCTCGTATTTGTTTCTCTTT
TGTTAAGATTACTATCGATTTGGTAAAAATAAACTAAATTTAATGATGAG
TGAAGAAGTAATTGCTAAGAACATTTCCTTGTCAAGTCTTACCTACCCAA
AGCGTATACCAAAGATTAAGTTCGGTCCTATCAAGGACGAAATGGGTTTC
ACGCTCAGCGAAAGATTGGCCCTCAGACAGGCGTGGAACTTGGTCAGACC
CTTTGAGCGGCGCTACGGTCAGGACGTATTCTATAGCTTCCTAAATGATT
ACTATTGGGGTATTAAGAAGTTCCGGAACGGAGCTGAGCTCAACGTGAAA
GCCCTGCACTCGCATGCCCTGCGATTTATTAACTTTTTTGGACTTCTAAT
CGAGGAGAAGGATCCAGTAGTGTTCCAGCTGATGATAAACGACAACAACC
ATACCCACAATCGCTGCCATGTGGGCTCCGTTAATATTGGGCATCTGGCC
CAGGCCCTGGTGGACTATGTGCTAAAGGTGTTCCATAAGGTCAGCTCTCC
ATCGCTGGAACAGGGTTTGAGCAAACTCGTGGAGAAGTTTCAGAACTACC
AGGACCAGCAGTCGAATACCTCCGGATACAATCGCCTGAGCAAGGTTAAC
TTTGATTCACGACCGCCCAGAGGTAACCCATAGGAAACCCAAAGGAAACC
TAACGAAACCCAGTGGCAACCAATAGGAAATTCATAAGAAACCCAAAGGA
AACCCATAGGAAACCCAAAGGAAACCCAAAGGAAACCCAGTGGAAGCCCA
GGCCATGAATCGTATTTGGAATTATATCGGGCTGCGTCATTCTGCCGCTG
TCTCTGCCGCTGCTACTGCCTCTGCCACCGCGATATCAGGCTTCTAGTAT
CAGCCTCTGTCGCTGTCGCCGACGCAGTGGGCGCTCATTTCGCTTAGCTG
CTAAGCGATTTCCTTGGAGAAATTCAGTTCAGCTCGGACGCTCGTCGCGC
CATCCACACGTTTCGATAGTTAAGCCTTTCAGGGAACTGGAGCGATCGAA
AAATTGGCAGTAGCAAAATAAACACTAATAAAACGAACATATAACCTCGC
ATTTGCGGGTTAATCGGCAAAAAAAAAAAAAAAAAAA

IP07107.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
glob3-RA 1118 glob3-RA 1..1118 1..1118 5590 100 Plus
CG1208-RB 2187 CG1208-RB 1..158 961..1118 790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1656804..1657431 491..1118 3140 100 Plus
chr3R 27901430 chr3R 1655708..1655993 1..286 1430 100 Plus
chr3R 27901430 chr3R 1656039..1656245 285..491 1035 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5831158..5831785 491..1118 3140 100 Plus
3R 32079331 3R 5830062..5830347 1..286 1430 100 Plus
3R 32079331 3R 5830393..5830599 285..491 1035 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5571989..5572616 491..1118 3140 100 Plus
3R 31820162 3R 5570893..5571178 1..286 1430 100 Plus
3R 31820162 3R 5571224..5571430 285..491 1035 100 Plus
Blast to na_te.dros performed 2019-03-15 21:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Juan 4236 Juan JUAN 4236bp 3507..3544 1049..1087 111 79.5 Plus

IP07107.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:36:08 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1657103..1657431 790..1118 100   Plus
chr3R 1656041..1656245 287..491 100 -> Plus
chr3R 1656805..1656987 492..674 100 == Plus
chr3R 1655708..1655993 1..286 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:33 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..591 93..683 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:29 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..591 93..683 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:53:20 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..591 93..683 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:20 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
CG14675-RA 1..591 93..683 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:58:17 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..591 93..683 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:59:20 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..1118 1..1118 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:29 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..1118 1..1118 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:53:20 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..1118 1..1118 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:21 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
CG14675-RA 1..1118 1..1118 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:58:17 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
glob3-RA 1..1118 1..1118 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:36:08 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5830062..5830347 1..286 100 -> Plus
3R 5830395..5830599 287..491 100 -> Plus
3R 5831159..5831785 492..1118 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:36:08 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5830062..5830347 1..286 100 -> Plus
3R 5830395..5830599 287..491 100 -> Plus
3R 5831159..5831785 492..1118 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:36:08 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5830062..5830347 1..286 100 -> Plus
3R 5830395..5830599 287..491 100 -> Plus
3R 5831159..5831785 492..1118 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:53:20 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1655784..1656069 1..286 100 -> Plus
arm_3R 1656117..1656321 287..491 100 -> Plus
arm_3R 1656881..1657507 492..1118 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:21 Download gff for IP07107.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5570893..5571178 1..286 100 -> Plus
3R 5571226..5571430 287..491 100 -> Plus
3R 5571990..5572616 492..1118 100   Plus

IP07107.pep Sequence

Translation from 92 to 682

> IP07107.pep
MMSEEVIAKNISLSSLTYPKRIPKIKFGPIKDEMGFTLSERLALRQAWNL
VRPFERRYGQDVFYSFLNDYYWGIKKFRNGAELNVKALHSHALRFINFFG
LLIEEKDPVVFQLMINDNNHTHNRCHVGSVNIGHLAQALVDYVLKVFHKV
SSPSLEQGLSKLVEKFQNYQDQQSNTSGYNRLSKVNFDSRPPRGNP*

IP07107.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16359-PA 206 GF16359-PA 20..191 12..181 543 58.7 Plus
Dana\GF16358-PA 206 GF16358-PA 29..172 17..169 191 31.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13071-PA 225 GG13071-PA 1..196 1..196 932 87.8 Plus
Dere\GG10391-PA 222 GG10391-PA 35..189 18..169 223 34.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18925-PA 208 GH18925-PA 25..189 15..177 410 45.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
glob3-PA 196 CG14675-PA 1..196 1..196 1031 100 Plus
glob2-PB 222 CG15180-PB 35..189 18..169 228 35.5 Plus
glob2-PC 219 CG15180-PC 35..184 18..164 227 36 Plus
glob2-PD 209 CG15180-PD 35..176 18..169 197 32.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23233-PA 192 GI23233-PA 15..182 8..176 400 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24032-PA 209 GL24032-PA 23..200 7..187 594 60.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26483-PA 209 GA26483-PA 23..200 7..187 592 60.3 Plus
Dpse\GA26482-PB 218 GA26482-PB 22..206 18..195 235 30.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10846-PA 196 GM10846-PA 1..196 1..196 976 93.4 Plus
Dsec\GM10544-PA 209 GM10544-PA 35..176 18..169 210 34.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19828-PA 196 GD19828-PA 1..196 1..196 974 93.4 Plus
Dsim\GD19540-PA 209 GD19540-PA 35..176 18..169 209 34.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22893-PA 208 GJ22893-PA 24..185 11..173 432 47.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14442-PA 206 GK14442-PA 23..188 18..187 452 50 Plus
Dwil\GK17234-PA 215 GK17234-PA 10..179 3..166 233 35.6 Plus
Dwil\GK24567-PA 218 GK24567-PA 23..171 18..163 210 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10172-PA 225 GE10172-PA 1..196 1..196 865 82.1 Plus
Dyak\GE24095-PA 209 GE24095-PA 35..176 18..169 190 31.6 Plus

IP07107.hyp Sequence

Translation from 92 to 682

> IP07107.hyp
MMSEEVIAKNISLSSLTYPKRIPKIKFGPIKDEMGFTLSERLALRQAWNL
VRPFERRYGQDVFYSFLNDYYWGIKKFRNGAELNVKALHSHALRFINFFG
LLIEEKDPVVFQLMINDNNHTHNRCHVGSVNIGHLAQALVDYVLKVFHKV
SSPSLEQGLSKLVEKFQNYQDQQSNTSGYNRLSKVNFDSRPPRGNP*

IP07107.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
glob3-PA 196 CG14675-PA 1..196 1..196 1031 100 Plus
glob2-PB 222 CG15180-PB 35..189 18..169 228 35.5 Plus
glob2-PC 219 CG15180-PC 35..184 18..164 227 36 Plus
glob2-PD 209 CG15180-PD 35..176 18..169 197 32.3 Plus