Clone IP07109 Report

Search the DGRC for IP07109

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:9
Vector:pOT2
Associated Gene/TranscriptCG14708-RA
Protein status:IP07109.pep: gold
Preliminary Size:618
Sequenced Size:753

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14708 2005-01-01 Successful iPCR screen
CG14708 2008-04-29 Release 5.5 accounting
CG14708 2008-08-15 Release 5.9 accounting
CG14708 2008-12-18 5.12 accounting

Clone Sequence Records

IP07109.complete Sequence

753 bp (753 high quality bases) assembled on 2005-01-13

GenBank Submission: BT022669

> IP07109.complete
AGTACAGTTAAATATATAGTGCAGTATAGCAGCATATCACTAAAATGGCC
GAGCAGCATTATAATGCAAATGATTTGGCTTCCGATCCAAATTCGCGTAA
ATTGAAGTTTGCCGGCATTTGCAAACTAAATAATAACGAGCTGTCGAGTC
TCTACAATATCGACAAGTTGACCGACGAGGAGCTGGCGTCCGTGAATCTG
GATAGGAGCTCCCTGATCGATGACTATCGTCTACTGCACGAGGTGTCGCA
GATGAAGCAAATAGAGAATGAAGCAAATAATATCCCTGCTGCTGCTCCAG
CAGGACAACCAAAATCCAAGGAGTTGCATGAGCAATTCGTAAAAGAGATG
GAGAAGTACCTTACCAATAAGAAGTACACATTTCCGATGCTCAACCATTT
GATCAAGTTAATGAGTTGGGAAGTGGAGCCGGAGACCATTTTCAACGAAA
AGGCGTTTCAGATTGATGTCAATTACCATGAGGACGAGGAGGTAATGCAG
CTGGAGCCCAATGAGCGTCTGTTTCGTCGCCTCAAGTCCATCTACGATCA
TCTGGAGGACATGTTCATCAACGGCAATCGCAGAACGGCCTCCGACCTGG
TCTTCACCGCAATTATCCGTTTGGTCGACCGCTCTAATGTGGCAAAATAT
AAAATCATATAATACAGCAATGCTATAAGAATGCTGAAGTTTCTTACAGC
TAATAAAAAAAATATGTAATTATCCAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

IP07109.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14708-RA 725 CG14708-RA 1..725 1..725 3625 100 Plus
CG15375-RA 813 CG15375-RA 43..224 93..274 385 80.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7379633..7380357 1..725 3625 100 Plus
chrX 22417052 chrX 3994702..3994883 93..274 370 80.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11554145..11554871 1..727 3635 100 Plus
X 23542271 X 4101450..4101631 93..274 385 80.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11294976..11295702 1..727 3635 100 Plus
X 23527363 X 4109548..4109729 93..274 385 80.7 Plus
Blast to na_te.dros performed 2019-03-16 08:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 7443..7517 639..710 133 68 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1021..1113 236..329 124 64.6 Plus

IP07109.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:16:31 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7379633..7380357 1..725 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:34 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..618 45..662 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:28 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..618 45..662 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:01 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..618 45..662 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:29 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..618 45..662 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:38:12 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..618 45..662 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:32 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..618 45..662 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:27 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..725 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:01 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..725 1..725 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:29 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..618 45..662 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:38:12 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
CG14708-RA 1..725 1..725 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:31 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11554145..11554869 1..725 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:31 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11554145..11554869 1..725 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:31 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11554145..11554869 1..725 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:01 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7379867..7380591 1..725 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:31 Download gff for IP07109.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11294976..11295700 1..725 100   Plus

IP07109.hyp Sequence

Translation from 44 to 661

> IP07109.hyp
MAEQHYNANDLASDPNSRKLKFAGICKLNNNELSSLYNIDKLTDEELASV
NLDRSSLIDDYRLLHEVSQMKQIENEANNIPAAAPAGQPKSKELHEQFVK
EMEKYLTNKKYTFPMLNHLIKLMSWEVEPETIFNEKAFQIDVNYHEDEEV
MQLEPNERLFRRLKSIYDHLEDMFINGNRRTASDLVFTAIIRLVDRSNVA
KYKII*

IP07109.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14708-PA 205 CG14708-PA 1..205 1..205 1054 100 Plus
CG15375-PB 233 CG15375-PB 2..167 4..193 371 46.8 Plus

IP07109.pep Sequence

Translation from 44 to 661

> IP07109.pep
MAEQHYNANDLASDPNSRKLKFAGICKLNNNELSSLYNIDKLTDEELASV
NLDRSSLIDDYRLLHEVSQMKQIENEANNIPAAAPAGQPKSKELHEQFVK
EMEKYLTNKKYTFPMLNHLIKLMSWEVEPETIFNEKAFQIDVNYHEDEEV
MQLEPNERLFRRLKSIYDHLEDMFINGNRRTASDLVFTAIIRLVDRSNVA
KYKII*

IP07109.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21491-PA 482 GF21491-PA 290..466 16..196 415 47.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18211-PA 209 GG18211-PA 1..193 1..196 622 62.8 Plus
Dere\GG18689-PA 218 GG18689-PA 5..185 7..196 440 51.1 Plus
Dere\GG18690-PA 184 GG18690-PA 9..175 28..198 229 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14708-PA 205 CG14708-PA 1..205 1..205 1054 100 Plus
CG15375-PB 233 CG15375-PB 2..167 4..193 371 46.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16148-PA 215 GI16148-PA 6..175 14..191 268 33.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14197-PA 154 GL14197-PA 65..120 16..71 183 55.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22394-PA 154 GA22394-PA 65..120 16..71 183 55.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23951-PA 204 GM23951-PA 1..204 1..205 923 85.9 Plus
Dsec\GM12322-PA 207 GM12322-PA 5..196 7..198 415 48.7 Plus
Dsec\GM12323-PA 138 GM12323-PA 10..127 78..196 174 33.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18762-PA 205 GD18762-PA 1..205 1..205 928 85.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16424-PA 214 GJ16424-PA 4..174 12..191 278 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20100-PA 234 GK20100-PA 6..204 16..193 302 36.9 Plus
Dwil\GK19771-PA 174 GK19771-PA 9..66 19..76 191 62.1 Plus
Dwil\GK20097-PA 190 GK20097-PA 9..66 19..76 177 60.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26103-PA 203 GE26103-PA 1..197 1..199 631 62.3 Plus
Dyak\GE16328-PA 218 GE16328-PA 5..185 7..196 464 52.6 Plus
Dyak\GE16329-PA 198 GE16329-PA 9..179 28..199 263 36.7 Plus