Clone IP07112 Report

Search the DGRC for IP07112

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:12
Vector:pOT2
Associated Gene/TranscriptCG14810-RA
Protein status:IP07112.pep: gold
Preliminary Size:555
Sequenced Size:738

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14810 2005-01-01 Successful iPCR screen
CG14810 2008-04-29 Release 5.5 accounting
CG14810 2008-08-15 Release 5.9 accounting
CG14810 2008-12-18 5.12 accounting

Clone Sequence Records

IP07112.complete Sequence

738 bp (738 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022670

> IP07112.complete
AAAGGATAGGTCATTACGATTGAGGACGACGACCAACTGCGCTAAGTCAT
AATTAAGCCAAAGATGGAAAAGAATCTACCGGCATCCATTTCGAAGAACA
AGAGATTCGAATCGACGATGATGAGTTCTCCCGTGCCAAGTTTTGCCAAG
TCCAATGGGATGAAAAAGAAGACTACGACCTTTTCACGATTCATCCGCAC
CGATCGTGCCGCAGGGGGCTTGACCAATGGGGTGAAAAAGAAGACTGTAT
CCGTTTCGCGATTCAGCCGCGTCCATCGTGTCGCAGAGGACCTGACCCGT
GAATTGGCCGGCATGTCGTTGAAAAAACAGGCTGTGCAACCGCGTCGTCG
TTATTCTTTCACCAATGAGTTCCCGGATGATCCACCAAAGCCAGCTCCCA
ACCGTCGCTGCTCGCTTGTCCGCCGCAACTCAATTAACCTCCCAATTGAG
TCCAATTTTGATATGTCCGTGCTGATGGATGATGATGATGAGGAGGAGGA
GGATGATGAGATGATGATGGCGAAGGAGGAGGATGATGAGATGATGATGG
CGAAGGAGGAGGAGGATGAAGTACAGGATCTAAATATGACCAGTGGCTCC
ATCAACCCAGCTACATCGACCTCGAAAGGCGCCATCCCGAAGCCGCCCAA
AAATTTCGGCTTTACCTTCTAGAAATGCAAGGACTAATAAATCAAGCTAG
CTGAGCGCTACGACTATTATAAAAAAAAAAAAAAAAAA

IP07112.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14810-RA 750 CG14810-RA 29..750 1..722 3610 100 Plus
CG14811-RA 651 CG14811-RA 383..545 335..497 530 88.3 Plus
CG14811-RA 651 CG14811-RA 1..207 118..324 495 82.6 Plus
CG14811-RA 651 CG14811-RA 536..651 557..672 370 87.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1713366..1713993 720..93 3095 99.5 Minus
chrX 22417052 chrX 1715815..1716045 324..94 615 84.4 Minus
chrX 22417052 chrX 1715477..1715639 497..335 515 87.7 Minus
chrX 22417052 chrX 1715323..1715486 720..557 490 86.6 Minus
chrX 22417052 chrX 1714054..1714111 93..36 290 100 Minus
chrX 22417052 chrX 1716109..1716164 91..36 190 89.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1819493..1820122 722..93 3150 100 Minus
X 23542271 X 1821944..1822174 324..94 615 84.4 Minus
X 23542271 X 1821606..1821768 497..335 530 88.3 Minus
X 23542271 X 1821450..1821615 722..557 500 86.7 Minus
X 23542271 X 1820183..1820240 93..36 290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1827591..1828220 722..93 3150 100 Minus
X 23527363 X 1830042..1830272 324..94 615 84.4 Minus
X 23527363 X 1829704..1829866 497..335 530 88.3 Minus
X 23527363 X 1829548..1829713 722..557 500 86.7 Minus
X 23527363 X 1828281..1828338 93..36 290 100 Minus
X 23527363 X 1828405..1828439 35..1 175 100 Minus
X 23527363 X 1830336..1830391 91..36 175 87.5 Minus
X 23527363 X 1830457..1830491 35..1 160 97.1 Minus
Blast to na_te.dros performed on 2019-03-16 19:39:29 has no hits.

IP07112.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:40:27 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1713366..1713536 550..720 100 == Minus
chrX 1713609..1713992 94..477 99 <- Minus
chrX 1714054..1714111 36..93 100 <- Minus
chrX 1714178..1714212 1..35 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:36 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..609 64..672 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:30 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..609 64..672 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:30 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..609 64..672 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:22 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..609 64..672 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:38:07 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..609 64..672 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:59:22 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..720 1..720 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:30 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..720 1..720 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:30 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..720 1..720 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:22 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..720 1..720 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:38:07 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
CG14810-RA 1..720 1..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:27 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
X 1820183..1820240 36..93 100 <- Minus
X 1820307..1820341 1..35 100   Minus
X 1819495..1820121 94..720 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:27 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
X 1820183..1820240 36..93 100 <- Minus
X 1820307..1820341 1..35 100   Minus
X 1819495..1820121 94..720 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:27 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
X 1820183..1820240 36..93 100 <- Minus
X 1820307..1820341 1..35 100   Minus
X 1819495..1820121 94..720 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:30 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1713528..1714154 94..720 100 <- Minus
arm_X 1714216..1714273 36..93 100 <- Minus
arm_X 1714340..1714374 1..35 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:23 Download gff for IP07112.complete
Subject Subject Range Query Range Percent Splice Strand
X 1827593..1828219 94..720 100 <- Minus
X 1828281..1828338 36..93 100 <- Minus
X 1828405..1828439 1..35 100   Minus

IP07112.hyp Sequence

Translation from 63 to 671

> IP07112.hyp
MEKNLPASISKNKRFESTMMSSPVPSFAKSNGMKKKTTTFSRFIRTDRAA
GGLTNGVKKKTVSVSRFSRVHRVAEDLTRELAGMSLKKQAVQPRRRYSFT
NEFPDDPPKPAPNRRCSLVRRNSINLPIESNFDMSVLMDDDDEEEEDDEM
MMAKEEDDEMMMAKEEEDEVQDLNMTSGSINPATSTSKGAIPKPPKNFGF
TF*

IP07112.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14810-PA 202 CG14810-PA 1..202 1..202 1035 100 Plus
CG14810-PB 201 CG14810-PB 1..201 1..202 1018 99.5 Plus
CG14811-PB 237 CG14811-PB 5..237 1..202 487 48.2 Plus

IP07112.pep Sequence

Translation from 63 to 671

> IP07112.pep
MEKNLPASISKNKRFESTMMSSPVPSFAKSNGMKKKTTTFSRFIRTDRAA
GGLTNGVKKKTVSVSRFSRVHRVAEDLTRELAGMSLKKQAVQPRRRYSFT
NEFPDDPPKPAPNRRCSLVRRNSINLPIESNFDMSVLMDDDDEEEEDDEM
MMAKEEDDEMMMAKEEEDEVQDLNMTSGSINPATSTSKGAIPKPPKNFGF
TF*

IP07112.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14810-PA 202 CG14810-PA 1..202 1..202 1035 100 Plus
CG14810-PB 201 CG14810-PB 1..201 1..202 1018 99.5 Plus
CG14811-PB 237 CG14811-PB 5..237 1..202 487 48.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18953-PA 479 GM18953-PA 302..479 12..202 473 63.2 Plus
Dsec\GM18953-PA 479 GM18953-PA 105..280 4..140 382 51.7 Plus
Dsec\GM18953-PA 479 GM18953-PA 6..87 2..91 211 58.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:43:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16413-PA 177 GD16413-PA 6..177 2..202 474 58.1 Plus
Dsim\GD16412-PA 225 GD16412-PA 5..225 1..202 460 47.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16510-PA 241 GE16510-PA 6..236 2..202 227 33.7 Plus