Clone IP07123 Report

Search the DGRC for IP07123

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:71
Well:23
Vector:pOT2
Associated Gene/TranscriptCG14984-RB
Protein status:IP07123.pep: gold
Preliminary Size:537
Sequenced Size:611

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14984 2005-01-01 Successful iPCR screen
CG14984 2008-04-29 Release 5.5 accounting
CG14984 2008-08-15 Release 5.9 accounting
CG14984 2008-12-18 5.12 accounting

Clone Sequence Records

IP07123.complete Sequence

611 bp (611 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022674

> IP07123.complete
TCGCGTCGATCGCAGTCCGCCATCAAATCGCGAGAAGTTCACAAATAGAA
TAGCCATGGTCAAGAAGACATCCGCCAGCCTGGGAAAGAGCATCTTGCTG
GGAGTTCTGTTGTTTCTCGCCGTACACGCACTTCTCACCGAGGCGGCCCC
CTTCCAGGAGCTGGAGCCTCGCAAAGGTCATGTGCCCGTCTACATCCGAC
ATGGCGATGAGCCACTCAGCGAAATCCATCCAGGACTGGCCGAGGCCTTC
AAGGAGGGCGAATCGAAGAGTCTCGTCACCGAATCTCCCCAGGCGGAAAC
TACAAACCCACCAACCACATCCGATGCTCCCGCTCCCGCTCCGTCCAGCT
CCACGGTATCGGATATAGCCAGCTTTGAGGCCATCAAAGGAAAGACGGAT
TAAGGAATTGAATAAATTCAAAAATTGCTGCTTAAACTTATTTAGTCTAC
GAGTTAAGTCCATCAAACGAAAGCGCCTAAGGTCTGGTGACAAATCAGCA
GGCGAAATGGTGTATATTTAAACATGAAATAAACATTTAAATAAGGCCAG
TTTTAACTGAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

IP07123.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14984-RB 852 CG14984-RB 219..783 1..565 2825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3950602..3950901 562..263 1455 99 Minus
chr3L 24539361 chr3L 3951664..3951806 143..1 715 100 Minus
chr3L 24539361 chr3L 3951155..3951280 268..143 615 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:50:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3951190..3951492 565..263 1500 99.7 Minus
3L 28110227 3L 3952261..3952403 143..1 715 100 Minus
3L 28110227 3L 3951752..3951877 268..143 630 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3951190..3951492 565..263 1500 99.6 Minus
3L 28103327 3L 3952261..3952403 143..1 715 100 Minus
3L 28103327 3L 3951752..3951877 268..143 630 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:13:15 has no hits.

IP07123.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:14:07 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3950602..3950895 269..562 99 <- Minus
chr3L 3951155..3951279 144..268 99 <- Minus
chr3L 3951664..3951806 1..143 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:31:38 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 1..348 56..403 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:08:31 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 1..348 56..403 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:54 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 1..348 56..403 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:53:23 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 1..348 56..403 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:33:54 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 1..348 56..403 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:59:24 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 18..579 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:08:31 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 18..579 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:54 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 18..579 1..562 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:53:25 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 18..579 1..562 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:33:54 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
CG14984-RB 18..579 1..562 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:14:07 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3952261..3952403 1..143 100   Minus
3L 3951752..3951876 144..268 100 <- Minus
3L 3951193..3951486 269..562 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:14:07 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3952261..3952403 1..143 100   Minus
3L 3951752..3951876 144..268 100 <- Minus
3L 3951193..3951486 269..562 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:14:07 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3952261..3952403 1..143 100   Minus
3L 3951752..3951876 144..268 100 <- Minus
3L 3951193..3951486 269..562 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:54 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3951193..3951486 269..562 100 <- Minus
arm_3L 3951752..3951876 144..268 100 <- Minus
arm_3L 3952261..3952403 1..143 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:28:24 Download gff for IP07123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3951193..3951486 269..562 100 <- Minus
3L 3951752..3951876 144..268 100 <- Minus
3L 3952261..3952403 1..143 100   Minus

IP07123.hyp Sequence

Translation from 0 to 402

> IP07123.hyp
RVDRSPPSNREKFTNRIAMVKKTSASLGKSILLGVLLFLAVHALLTEAAP
FQELEPRKGHVPVYIRHGDEPLSEIHPGLAEAFKEGESKSLVTESPQAET
TNPPTTSDAPAPAPSSSTVSDIASFEAIKGKTD*

IP07123.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG14984-PC 115 CG14984-PC 1..115 19..133 577 100 Plus
CG14984-PB 115 CG14984-PB 1..115 19..133 577 100 Plus

IP07123.pep Sequence

Translation from 1 to 402

> IP07123.pep
RVDRSPPSNREKFTNRIAMVKKTSASLGKSILLGVLLFLAVHALLTEAAP
FQELEPRKGHVPVYIRHGDEPLSEIHPGLAEAFKEGESKSLVTESPQAET
TNPPTTSDAPAPAPSSSTVSDIASFEAIKGKTD*

IP07123.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24782-PA 115 GF24782-PA 5..112 30..132 271 67 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14233-PA 121 GG14233-PA 39..121 49..133 399 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15708-PA 130 GH15708-PA 9..102 32..131 247 56.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14984-PC 115 CG14984-PC 1..115 19..133 577 100 Plus
CG14984-PB 115 CG14984-PB 1..115 19..133 577 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12764-PA 90 GI12764-PA 1..85 19..130 232 48.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16199-PA 121 GL16199-PA 21..115 45..130 285 65.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13404-PA 121 GA13404-PA 21..115 45..130 290 68.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14025-PA 112 GM14025-PA 3..112 22..133 457 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13306-PA 125 GD13306-PA 40..125 48..133 435 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16105-PA 108 GJ16105-PA 6..106 30..131 275 59.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16693-PA 106 GK16693-PA 15..106 48..133 261 62 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20661-PA 111 GE20661-PA 3..111 22..133 487 90.2 Plus